| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335713.1 | 5prime_partial | 239 | 2-721(+) |
Amino Acid sequence : | |||
| HPVAVRSNTLALHSPPPSIRRKSRLPFSIRMSSSAAPNQIIEHIVLFKAKPDAEPSAVNAMLRNLNALSSLDSVLHISAGPVARCRSSALTFTHMLHSRYRSKSDLASYTDDPTHVGVVT NYVKPVVDDVMAVDWVADDFSGAAEVPPGAALRLTVLKLKEEAGESGKSEVLAAVRGIKDKFGSIEQLTVGENFSPGRAKGFSIASIAVFKGEKELEALGAATEEKDKVREFLDQVLGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 15,331.833 | ||
| Theoretical pI: | 9.747 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 124.580 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.708 | ||
Secondary Structure Fraction | |||
| Helix | 0.092 | ||
| turn | 0.569 | ||
| sheet | 0.124 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335713.1 | 5prime_partial | 169 | 1-510(+) |
Amino Acid sequence : | |||
| APGCCPQQYPRPPLPAAVNPPQIPPPFLHQNVFLRRPQPDHRTHRPIQSQARRRALRRQRHAPQPQRPLLPRFRPPHLRRPRRPLPLLRPHLHPHAPLPLPIQIRPRLLHRRSHPRRRRH QLRQARRGRRHGRRLGRRRFLRCRGGASRSSAAVDRAEAEGGGGGEREE* | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 15,331.833 | ||
| Theoretical pI: | 9.747 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 124.580 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.708 | ||
Secondary Structure Fraction | |||
| Helix | 0.092 | ||
| turn | 0.569 | ||
| sheet | 0.124 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335713.1 | 5prime_partial | 153 | 3-464(+) |
Amino Acid sequence : | |||
| TRLLSAAIPSPSTPRRRQSAANPASLSPSECLPPPPPTRSSNTSSYSKPSPTPSPPPSTPCSATSTPSPPSIPSSTSPPAPSPAAAPPPSPSPTCSTPATDPNPTSPPTPTIPPTSASSP TTSSPSWTTSWPSIGSPTISPVPRRCLPEQRCG* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 15,331.833 | ||
| Theoretical pI: | 9.747 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 124.580 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.708 | ||
Secondary Structure Fraction | |||
| Helix | 0.092 | ||
| turn | 0.569 | ||
| sheet | 0.124 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335713.1 | 5prime_partial | 239 | 2-721(+) |
Amino Acid sequence : | |||
| HPVAVRSNTLALHSPPPSIRRKSRLPFSIRMSSSAAPNQIIEHIVLFKAKPDAEPSAVNAMLRNLNALSSLDSVLHISAGPVARCRSSALTFTHMLHSRYRSKSDLASYTDDPTHVGVVT NYVKPVVDDVMAVDWVADDFSGAAEVPPGAALRLTVLKLKEEAGESGKSEVLAAVRGIKDKFGSIEQLTVGENFSPGRAKGFSIASIAVFKGEKELEALGAATEEKDKVREFLDQVLGA* | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 15,331.833 | ||
| Theoretical pI: | 9.747 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 124.580 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.708 | ||
Secondary Structure Fraction | |||
| Helix | 0.092 | ||
| turn | 0.569 | ||
| sheet | 0.124 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335713.1 | 5prime_partial | 169 | 1-510(+) |
Amino Acid sequence : | |||
| APGCCPQQYPRPPLPAAVNPPQIPPPFLHQNVFLRRPQPDHRTHRPIQSQARRRALRRQRHAPQPQRPLLPRFRPPHLRRPRRPLPLLRPHLHPHAPLPLPIQIRPRLLHRRSHPRRRRH QLRQARRGRRHGRRLGRRRFLRCRGGASRSSAAVDRAEAEGGGGGEREE* | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 15,331.833 | ||
| Theoretical pI: | 9.747 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 124.580 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.708 | ||
Secondary Structure Fraction | |||
| Helix | 0.092 | ||
| turn | 0.569 | ||
| sheet | 0.124 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335713.1 | 5prime_partial | 153 | 3-464(+) |
Amino Acid sequence : | |||
| TRLLSAAIPSPSTPRRRQSAANPASLSPSECLPPPPPTRSSNTSSYSKPSPTPSPPPSTPCSATSTPSPPSIPSSTSPPAPSPAAAPPPSPSPTCSTPATDPNPTSPPTPTIPPTSASSP TTSSPSWTTSWPSIGSPTISPVPRRCLPEQRCG* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 15,331.833 | ||
| Theoretical pI: | 9.747 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 124.580 | ||
| aromaticity | 0.020 | ||
| GRAVY | -0.708 | ||
Secondary Structure Fraction | |||
| Helix | 0.092 | ||
| turn | 0.569 | ||
| sheet | 0.124 | ||