Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335713.1 | 5prime_partial | 239 | 2-721(+) |
Amino Acid sequence : | |||
HPVAVRSNTLALHSPPPSIRRKSRLPFSIRMSSSAAPNQIIEHIVLFKAKPDAEPSAVNAMLRNLNALSSLDSVLHISAGPVARCRSSALTFTHMLHSRYRSKSDLASYTDDPTHVGVVT NYVKPVVDDVMAVDWVADDFSGAAEVPPGAALRLTVLKLKEEAGESGKSEVLAAVRGIKDKFGSIEQLTVGENFSPGRAKGFSIASIAVFKGEKELEALGAATEEKDKVREFLDQVLGA* | |||
Physicochemical properties | |||
Number of amino acids: | 239 | ||
Molecular weight: | 15,331.833 | ||
Theoretical pI: | 9.747 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
Instability index: | 124.580 | ||
aromaticity | 0.020 | ||
GRAVY | -0.708 | ||
Secondary Structure Fraction | |||
Helix | 0.092 | ||
turn | 0.569 | ||
sheet | 0.124 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335713.1 | 5prime_partial | 169 | 1-510(+) |
Amino Acid sequence : | |||
APGCCPQQYPRPPLPAAVNPPQIPPPFLHQNVFLRRPQPDHRTHRPIQSQARRRALRRQRHAPQPQRPLLPRFRPPHLRRPRRPLPLLRPHLHPHAPLPLPIQIRPRLLHRRSHPRRRRH QLRQARRGRRHGRRLGRRRFLRCRGGASRSSAAVDRAEAEGGGGGEREE* | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 15,331.833 | ||
Theoretical pI: | 9.747 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
Instability index: | 124.580 | ||
aromaticity | 0.020 | ||
GRAVY | -0.708 | ||
Secondary Structure Fraction | |||
Helix | 0.092 | ||
turn | 0.569 | ||
sheet | 0.124 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335713.1 | 5prime_partial | 153 | 3-464(+) |
Amino Acid sequence : | |||
TRLLSAAIPSPSTPRRRQSAANPASLSPSECLPPPPPTRSSNTSSYSKPSPTPSPPPSTPCSATSTPSPPSIPSSTSPPAPSPAAAPPPSPSPTCSTPATDPNPTSPPTPTIPPTSASSP TTSSPSWTTSWPSIGSPTISPVPRRCLPEQRCG* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 15,331.833 | ||
Theoretical pI: | 9.747 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
Instability index: | 124.580 | ||
aromaticity | 0.020 | ||
GRAVY | -0.708 | ||
Secondary Structure Fraction | |||
Helix | 0.092 | ||
turn | 0.569 | ||
sheet | 0.124 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335713.1 | 5prime_partial | 239 | 2-721(+) |
Amino Acid sequence : | |||
HPVAVRSNTLALHSPPPSIRRKSRLPFSIRMSSSAAPNQIIEHIVLFKAKPDAEPSAVNAMLRNLNALSSLDSVLHISAGPVARCRSSALTFTHMLHSRYRSKSDLASYTDDPTHVGVVT NYVKPVVDDVMAVDWVADDFSGAAEVPPGAALRLTVLKLKEEAGESGKSEVLAAVRGIKDKFGSIEQLTVGENFSPGRAKGFSIASIAVFKGEKELEALGAATEEKDKVREFLDQVLGA* | |||
Physicochemical properties | |||
Number of amino acids: | 239 | ||
Molecular weight: | 15,331.833 | ||
Theoretical pI: | 9.747 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
Instability index: | 124.580 | ||
aromaticity | 0.020 | ||
GRAVY | -0.708 | ||
Secondary Structure Fraction | |||
Helix | 0.092 | ||
turn | 0.569 | ||
sheet | 0.124 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335713.1 | 5prime_partial | 169 | 1-510(+) |
Amino Acid sequence : | |||
APGCCPQQYPRPPLPAAVNPPQIPPPFLHQNVFLRRPQPDHRTHRPIQSQARRRALRRQRHAPQPQRPLLPRFRPPHLRRPRRPLPLLRPHLHPHAPLPLPIQIRPRLLHRRSHPRRRRH QLRQARRGRRHGRRLGRRRFLRCRGGASRSSAAVDRAEAEGGGGGEREE* | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 15,331.833 | ||
Theoretical pI: | 9.747 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
Instability index: | 124.580 | ||
aromaticity | 0.020 | ||
GRAVY | -0.708 | ||
Secondary Structure Fraction | |||
Helix | 0.092 | ||
turn | 0.569 | ||
sheet | 0.124 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335713.1 | 5prime_partial | 153 | 3-464(+) |
Amino Acid sequence : | |||
TRLLSAAIPSPSTPRRRQSAANPASLSPSECLPPPPPTRSSNTSSYSKPSPTPSPPPSTPCSATSTPSPPSIPSSTSPPAPSPAAAPPPSPSPTCSTPATDPNPTSPPTPTIPPTSASSP TTSSPSWTTSWPSIGSPTISPVPRRCLPEQRCG* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 15,331.833 | ||
Theoretical pI: | 9.747 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
Instability index: | 124.580 | ||
aromaticity | 0.020 | ||
GRAVY | -0.708 | ||
Secondary Structure Fraction | |||
Helix | 0.092 | ||
turn | 0.569 | ||
sheet | 0.124 |