| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335748.1 | 5prime_partial | 252 | 3-761(+) |
Amino Acid sequence : | |||
| TRSRAEFGTRSNTFSYYDQVLDTTAMLGAVPLRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFIVPELGPDVKFSYSSHKAVNEYKEAKALGVDTVPVLVGPVTYLLLSKPA KGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTSLSGISGYGFDLVRGAQTIDLIKGGFPSGKYL FAGVVDGRNIWA* | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 27,654.179 | ||
| Theoretical pI: | 5.154 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44350 44350 | ||
| Instability index: | 28.079 | ||
| aromaticity | 0.131 | ||
| GRAVY | 0.044 | ||
Secondary Structure Fraction | |||
| Helix | 0.357 | ||
| turn | 0.238 | ||
| sheet | 0.274 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335748.1 | 5prime_partial | 252 | 3-761(+) |
Amino Acid sequence : | |||
| TRSRAEFGTRSNTFSYYDQVLDTTAMLGAVPLRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFIVPELGPDVKFSYSSHKAVNEYKEAKALGVDTVPVLVGPVTYLLLSKPA KGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTSLSGISGYGFDLVRGAQTIDLIKGGFPSGKYL FAGVVDGRNIWA* | |||
Physicochemical properties | |||
| Number of amino acids: | 252 | ||
| Molecular weight: | 27,654.179 | ||
| Theoretical pI: | 5.154 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44350 44350 | ||
| Instability index: | 28.079 | ||
| aromaticity | 0.131 | ||
| GRAVY | 0.044 | ||
Secondary Structure Fraction | |||
| Helix | 0.357 | ||
| turn | 0.238 | ||
| sheet | 0.274 | ||