Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335748.1 | 5prime_partial | 252 | 3-761(+) |
Amino Acid sequence : | |||
TRSRAEFGTRSNTFSYYDQVLDTTAMLGAVPLRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFIVPELGPDVKFSYSSHKAVNEYKEAKALGVDTVPVLVGPVTYLLLSKPA KGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTSLSGISGYGFDLVRGAQTIDLIKGGFPSGKYL FAGVVDGRNIWA* | |||
Physicochemical properties | |||
Number of amino acids: | 252 | ||
Molecular weight: | 27,654.179 | ||
Theoretical pI: | 5.154 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44350 44350 | ||
Instability index: | 28.079 | ||
aromaticity | 0.131 | ||
GRAVY | 0.044 | ||
Secondary Structure Fraction | |||
Helix | 0.357 | ||
turn | 0.238 | ||
sheet | 0.274 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335748.1 | 5prime_partial | 252 | 3-761(+) |
Amino Acid sequence : | |||
TRSRAEFGTRSNTFSYYDQVLDTTAMLGAVPLRYNWTGGEIGFSTYFSMARGNASVPAMEMTKWFDTNYHFIVPELGPDVKFSYSSHKAVNEYKEAKALGVDTVPVLVGPVTYLLLSKPA KGVEKTFPLLSLLDRILPIYKEVIAELKAAGASWIQFDEPTLVLDLEPYQLDAFTKAYAELESSLSGVNTLIETYFADVPAAAYKTLTSLSGISGYGFDLVRGAQTIDLIKGGFPSGKYL FAGVVDGRNIWA* | |||
Physicochemical properties | |||
Number of amino acids: | 252 | ||
Molecular weight: | 27,654.179 | ||
Theoretical pI: | 5.154 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 44350 44350 | ||
Instability index: | 28.079 | ||
aromaticity | 0.131 | ||
GRAVY | 0.044 | ||
Secondary Structure Fraction | |||
Helix | 0.357 | ||
turn | 0.238 | ||
sheet | 0.274 |