| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335754.1 | internal | 235 | 2-706(+) |
Amino Acid sequence : | |||
| HPLIVRDTCRSIGFVPYNVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEDIGAGDQAHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMV PIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLA | |||
Physicochemical properties | |||
| Number of amino acids: | 235 | ||
| Molecular weight: | 15,321.801 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 23.010 | ||
| aromaticity | 0.007 | ||
| GRAVY | 0.016 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.265 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335754.1 | 5prime_partial | 151 | 706-251(-) |
Amino Acid sequence : | |||
| SEPVGNDALGRLPDDVGATPVDLGGVLPGEGPATVGAPPAVGVDDDLTAGETRIAVGPTDDETPGGVKVEDGLLVQVLLGDDWLDDVLLEIPRDLVVGDGLVVLGRDEDGVDPDGDHRTV LVVVLDGDLGLPVGSQPRARTVLADLRQTSA* | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 15,321.801 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 23.010 | ||
| aromaticity | 0.007 | ||
| GRAVY | 0.016 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.265 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335754.1 | internal | 235 | 2-706(+) |
Amino Acid sequence : | |||
| HPLIVRDTCRSIGFVPYNVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEDIGAGDQAHMFGYATDETPEYMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMV PIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGLA | |||
Physicochemical properties | |||
| Number of amino acids: | 235 | ||
| Molecular weight: | 15,321.801 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 23.010 | ||
| aromaticity | 0.007 | ||
| GRAVY | 0.016 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.265 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335754.1 | 5prime_partial | 151 | 706-251(-) |
Amino Acid sequence : | |||
| SEPVGNDALGRLPDDVGATPVDLGGVLPGEGPATVGAPPAVGVDDDLTAGETRIAVGPTDDETPGGVKVEDGLLVQVLLGDDWLDDVLLEIPRDLVVGDGLVVLGRDEDGVDPDGDHRTV LVVVLDGDLGLPVGSQPRARTVLADLRQTSA* | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 15,321.801 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 23.010 | ||
| aromaticity | 0.007 | ||
| GRAVY | 0.016 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.265 | ||
| sheet | 0.252 | ||