| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335772.1 | 5prime_partial | 105 | 1-318(+) |
Amino Acid sequence : | |||
| ARGEDKMDLILVVGGWNSSNTSHLQEIAELRGIPSYWVDSEKRIGPGSKISHKLMHGELVEKENWLPEGPITIGVTSGASTPDKVVEDVLQRVFDLKREELLQSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,649.068 | ||
| Theoretical pI: | 5.132 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
| Instability index: | 53.099 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.375 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.267 | ||
| sheet | 0.257 | ||