Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335772.1 | 5prime_partial | 105 | 1-318(+) |
Amino Acid sequence : | |||
ARGEDKMDLILVVGGWNSSNTSHLQEIAELRGIPSYWVDSEKRIGPGSKISHKLMHGELVEKENWLPEGPITIGVTSGASTPDKVVEDVLQRVFDLKREELLQSV* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,649.068 | ||
Theoretical pI: | 5.132 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
Instability index: | 53.099 | ||
aromaticity | 0.048 | ||
GRAVY | -0.375 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.267 | ||
sheet | 0.257 |