| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335777.1 | 5prime_partial | 231 | 1-696(+) |
Amino Acid sequence : | |||
| PNSXRGSNLEALFSAEIASSPRLSDQAAAFGVFSPSHKSAVLNQIQQQQNILSPINTNVFSPRNVDHPLLQASFGVSSPRMSPRSMEPASPMSARLAFAQRERQQQQQMRSLSSRELGSN RASVGSPTTAWSKWGAPNGKADWSVPADHEDFSKKPSSFDPKTTDGEEPDLSWVQSLVKESPPEMMDKTAAPSSGAAPSGECLPNPQTDSPVDHSVLGAWLDQMRLDQLVV* | |||
Physicochemical properties | |||
| Number of amino acids: | 231 | ||
| Molecular weight: | 24,851.274 | ||
| Theoretical pI: | 5.580 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27500 | ||
| Instability index: | 67.759 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.616 | ||
Secondary Structure Fraction | |||
| Helix | 0.204 | ||
| turn | 0.352 | ||
| sheet | 0.248 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335777.1 | 5prime_partial | 231 | 1-696(+) |
Amino Acid sequence : | |||
| PNSXRGSNLEALFSAEIASSPRLSDQAAAFGVFSPSHKSAVLNQIQQQQNILSPINTNVFSPRNVDHPLLQASFGVSSPRMSPRSMEPASPMSARLAFAQRERQQQQQMRSLSSRELGSN RASVGSPTTAWSKWGAPNGKADWSVPADHEDFSKKPSSFDPKTTDGEEPDLSWVQSLVKESPPEMMDKTAAPSSGAAPSGECLPNPQTDSPVDHSVLGAWLDQMRLDQLVV* | |||
Physicochemical properties | |||
| Number of amino acids: | 231 | ||
| Molecular weight: | 24,851.274 | ||
| Theoretical pI: | 5.580 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27500 | ||
| Instability index: | 67.759 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.616 | ||
Secondary Structure Fraction | |||
| Helix | 0.204 | ||
| turn | 0.352 | ||
| sheet | 0.248 | ||