| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335779.1 | 5prime_partial | 181 | 2-547(+) |
Amino Acid sequence : | |||
| HAVPVLLLSNFPTMDFLSGLAKGDDSKKSGDEKSTTELFASAKVVAEAAQAQFSNQPEKYDKAKAAGAAADILDAAEKYGKLDQTQGVGKYVDQAENYLRQYGTTPSAAAATPPASGEEK PAPTATETSAPSGAKPSEGGAGDYLKKAEELLGKPSEGGEKKEAEGGYGGLMNAASGFLNK* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 18,563.233 | ||
| Theoretical pI: | 4.941 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10430 | ||
| Instability index: | 27.927 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.617 | ||
Secondary Structure Fraction | |||
| Helix | 0.182 | ||
| turn | 0.282 | ||
| sheet | 0.348 | ||