Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335779.1 | 5prime_partial | 181 | 2-547(+) |
Amino Acid sequence : | |||
HAVPVLLLSNFPTMDFLSGLAKGDDSKKSGDEKSTTELFASAKVVAEAAQAQFSNQPEKYDKAKAAGAAADILDAAEKYGKLDQTQGVGKYVDQAENYLRQYGTTPSAAAATPPASGEEK PAPTATETSAPSGAKPSEGGAGDYLKKAEELLGKPSEGGEKKEAEGGYGGLMNAASGFLNK* | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 18,563.233 | ||
Theoretical pI: | 4.941 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10430 | ||
Instability index: | 27.927 | ||
aromaticity | 0.066 | ||
GRAVY | -0.617 | ||
Secondary Structure Fraction | |||
Helix | 0.182 | ||
turn | 0.282 | ||
sheet | 0.348 |