| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335789.1 | internal | 266 | 1-798(+) |
Amino Acid sequence : | |||
| YSLSFYFALPALLVSLLIFFFSRNSSSKKLNLPPGPPGHPLVGNLFQVALSGKPFFQYIRDLIPKYGRIFTLKMGTRTMIVVSSNKLAYEALIEKGQIFATRPTENPTRTIFSSDKFSVN AAFYGSVWRSLRKNMVQNMLSNARIKEFRPTRISAMDKLIERLKAEAAANDGVVWVLRNARFAVFCILLDMCFGVDMSEETIQTVDDMMKAVLIVLDPRIDDFLPILRPFFSKQRKRVQQ VRKSQIETLVPLIEQRREAIKNPDLH | |||
Physicochemical properties | |||
| Number of amino acids: | 266 | ||
| Molecular weight: | 30,457.435 | ||
| Theoretical pI: | 10.034 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 40.408 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.006 | ||
Secondary Structure Fraction | |||
| Helix | 0.357 | ||
| turn | 0.218 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335789.1 | internal | 266 | 1-798(+) |
Amino Acid sequence : | |||
| YSLSFYFALPALLVSLLIFFFSRNSSSKKLNLPPGPPGHPLVGNLFQVALSGKPFFQYIRDLIPKYGRIFTLKMGTRTMIVVSSNKLAYEALIEKGQIFATRPTENPTRTIFSSDKFSVN AAFYGSVWRSLRKNMVQNMLSNARIKEFRPTRISAMDKLIERLKAEAAANDGVVWVLRNARFAVFCILLDMCFGVDMSEETIQTVDDMMKAVLIVLDPRIDDFLPILRPFFSKQRKRVQQ VRKSQIETLVPLIEQRREAIKNPDLH | |||
Physicochemical properties | |||
| Number of amino acids: | 266 | ||
| Molecular weight: | 30,457.435 | ||
| Theoretical pI: | 10.034 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
| Instability index: | 40.408 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.006 | ||
Secondary Structure Fraction | |||
| Helix | 0.357 | ||
| turn | 0.218 | ||
| sheet | 0.252 | ||