Acc_NO	ORF type	length	start-end position (strand +/-)
>DY335793.1	5prime_partial	159	1-480(+)
Amino Acid sequence :
ARVNHWLDDGAYLMVKLLNKLASAKASGVGKGSKVLTDMVDGLEEPAFSVELRLKIDQNHEDVRGGSFRTYGEAVLQNLENAISSDPKLHKAPVNYEGVRVSGYGGWFLLRLSLHDPVLP LNIEAPSREDAIKLGLAVLSAVSEFKALDASALNKFVQA*
Physicochemical properties
Number of amino acids:		159
Molecular weight:		11,798.589
Theoretical pI:		10.006
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22460 22460
Instability index:		18.744
aromaticity		0.133
GRAVY		-0.121
Secondary Structure Fraction
Helix		0.305
turn		0.248
sheet		0.248

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY335793.1	5prime_partial	105	659-342(-)
Amino Acid sequence :
TQNPLFQRFKQKMGLIYPWFIHSYKQGTCFKNIFSISEKPPWAVDAAGKTPIMLIMTYLDYAWTNLFKADASRALNSLTADRTARPSLMASSLLGASIFRGKTGS*
Physicochemical properties
Number of amino acids:		105
Molecular weight:		11,798.589
Theoretical pI:		10.006
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		22460 22460
Instability index:		18.744
aromaticity		0.133
GRAVY		-0.121
Secondary Structure Fraction
Helix		0.305
turn		0.248
sheet		0.248