| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335803.1 | internal | 259 | 1-777(+) |
Amino Acid sequence : | |||
| HDVGTKYRGEFEERLTMLMEEIKQSDEIILFIDEVHTLIGPGAAEGAIDAANILKPASARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKLRY TDEALVAAAQLSHQYISDRFLPDKAIDLVDEAGSRVRLRHAQLPEEARELERELRQITKEKNEAVRSQDFEKAGELRDREMDLKAQISALIDKNKEMSKAESEAGDGGPVVTEVDIQHIV SSWTGIPVEKVSTDESDRL | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 29,315.626 | ||
| Theoretical pI: | 4.988 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 42.488 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.625 | ||
Secondary Structure Fraction | |||
| Helix | 0.266 | ||
| turn | 0.158 | ||
| sheet | 0.324 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335803.1 | internal | 259 | 1-777(+) |
Amino Acid sequence : | |||
| HDVGTKYRGEFEERLTMLMEEIKQSDEIILFIDEVHTLIGPGAAEGAIDAANILKPASARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKLRY TDEALVAAAQLSHQYISDRFLPDKAIDLVDEAGSRVRLRHAQLPEEARELERELRQITKEKNEAVRSQDFEKAGELRDREMDLKAQISALIDKNKEMSKAESEAGDGGPVVTEVDIQHIV SSWTGIPVEKVSTDESDRL | |||
Physicochemical properties | |||
| Number of amino acids: | 259 | ||
| Molecular weight: | 29,315.626 | ||
| Theoretical pI: | 4.988 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
| Instability index: | 42.488 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.625 | ||
Secondary Structure Fraction | |||
| Helix | 0.266 | ||
| turn | 0.158 | ||
| sheet | 0.324 | ||