Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335803.1 | internal | 259 | 1-777(+) |
Amino Acid sequence : | |||
HDVGTKYRGEFEERLTMLMEEIKQSDEIILFIDEVHTLIGPGAAEGAIDAANILKPASARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKLRY TDEALVAAAQLSHQYISDRFLPDKAIDLVDEAGSRVRLRHAQLPEEARELERELRQITKEKNEAVRSQDFEKAGELRDREMDLKAQISALIDKNKEMSKAESEAGDGGPVVTEVDIQHIV SSWTGIPVEKVSTDESDRL | |||
Physicochemical properties | |||
Number of amino acids: | 259 | ||
Molecular weight: | 29,315.626 | ||
Theoretical pI: | 4.988 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 42.488 | ||
aromaticity | 0.042 | ||
GRAVY | -0.625 | ||
Secondary Structure Fraction | |||
Helix | 0.266 | ||
turn | 0.158 | ||
sheet | 0.324 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335803.1 | internal | 259 | 1-777(+) |
Amino Acid sequence : | |||
HDVGTKYRGEFEERLTMLMEEIKQSDEIILFIDEVHTLIGPGAAEGAIDAANILKPASARGELQCIGATTLDEYRKHIEKDPALERRFQPVKVPEPSVDETIQILKGLRERYEIHHKLRY TDEALVAAAQLSHQYISDRFLPDKAIDLVDEAGSRVRLRHAQLPEEARELERELRQITKEKNEAVRSQDFEKAGELRDREMDLKAQISALIDKNKEMSKAESEAGDGGPVVTEVDIQHIV SSWTGIPVEKVSTDESDRL | |||
Physicochemical properties | |||
Number of amino acids: | 259 | ||
Molecular weight: | 29,315.626 | ||
Theoretical pI: | 4.988 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 12950 | ||
Instability index: | 42.488 | ||
aromaticity | 0.042 | ||
GRAVY | -0.625 | ||
Secondary Structure Fraction | |||
Helix | 0.266 | ||
turn | 0.158 | ||
sheet | 0.324 |