| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335806.1 | complete | 156 | 43-513(+) |
Amino Acid sequence : | |||
| MSLITDEMRTAASEIYHGDEICQEKSKFLLTEVGLPNGLLPLKDIVECGYIKETGFVWLIQKEKTEHKFEKIGKLVQYATEVTAYVEPGRIRKLTGVKAKELLLWVGLTDINMDSTTAKI TFKSIAGLSRTFPVDAFVVEEKVKTTAASGDLVKEV* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 17,384.017 | ||
| Theoretical pI: | 5.785 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 27.912 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.051 | ||
Secondary Structure Fraction | |||
| Helix | 0.340 | ||
| turn | 0.154 | ||
| sheet | 0.288 | ||