| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335808.1 | 5prime_partial | 225 | 1-678(+) |
Amino Acid sequence : | |||
| ARVLNGVAKSADRGFPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAIIMFDVTARLTYKNVPTWHRDLCRVCE NIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFVESPALAPPEVQIDLVAQQQHEAELAQAANQPLPDDDDEAFD* | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 25,468.691 | ||
| Theoretical pI: | 7.784 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24410 24785 | ||
| Instability index: | 26.353 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.419 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.196 | ||
| sheet | 0.218 | ||