Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335815.1 | complete | 147 | 86-529(+) |
Amino Acid sequence : | |||
MAEAEEQAKKKRTFRKFTYRGVDLDQLLDLPQEQLAQLLCCRARRRFYRGLKRKPMVLITKLRKAKKEAPPNEKPEVVKTHLRNMIIAPEMVGSIVGVYNGKTFTQVEIKPEMIGHYLGE FSMTYKPVKHGRPGIGATHSSRFIPLK* | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 16,951.881 | ||
Theoretical pI: | 10.155 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
Instability index: | 38.761 | ||
aromaticity | 0.075 | ||
GRAVY | -0.550 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.184 | ||
sheet | 0.265 |