| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335815.1 | complete | 147 | 86-529(+) |
Amino Acid sequence : | |||
| MAEAEEQAKKKRTFRKFTYRGVDLDQLLDLPQEQLAQLLCCRARRRFYRGLKRKPMVLITKLRKAKKEAPPNEKPEVVKTHLRNMIIAPEMVGSIVGVYNGKTFTQVEIKPEMIGHYLGE FSMTYKPVKHGRPGIGATHSSRFIPLK* | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 16,951.881 | ||
| Theoretical pI: | 10.155 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 38.761 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.550 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.184 | ||
| sheet | 0.265 | ||