| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335818.1 | internal | 223 | 1-669(+) |
Amino Acid sequence : | |||
| PFLTSIPALLARPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSHPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVF AWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEDYDKTGKLPDPSSTDNAEFQIVLTLIRYGLKANPSKYRNMKERLVGVSEETTTGV | |||
Physicochemical properties | |||
| Number of amino acids: | 223 | ||
| Molecular weight: | 11,341.075 | ||
| Theoretical pI: | 11.802 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 28990 | ||
| Instability index: | 49.754 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.331 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.280 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335818.1 | 5prime_partial | 214 | 669-25(-) |
Amino Acid sequence : | |||
| HPSSCFLRNTNQSLLHVPILAGIGLQPVSDQRQHYLKLRIIGRAGVRQLPRLIVILLRLHALVDQQSSITAIVHDEVGAAARAPVEGPLRAPPVLLQGLTLPGEDGGAVASNGSGGVVLS GEDVARAPSDLSAESGKGLNEDGSLDGHVETSGDPGALEGMGGAELGPAGNEARHLHLSELDFEAAEVGLGHVLDLVLAAGGGLLHLERHGSSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 11,341.075 | ||
| Theoretical pI: | 11.802 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 28990 | ||
| Instability index: | 49.754 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.331 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.280 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335818.1 | 3prime_partial | 100 | 302-3(-) |
Amino Acid sequence : | |||
| MLQEHHLTSAPRAVRVSMRTAVWMVMWRLPVIRAPLKGWEGPNSVRQEMRPGISTSASSISRRPKSAWDMSLTLYSRPEVVFSTWSAMGRASRAGMDVRN | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,341.075 | ||
| Theoretical pI: | 11.802 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 28990 | ||
| Instability index: | 49.754 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.331 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.280 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335818.1 | internal | 223 | 1-669(+) |
Amino Acid sequence : | |||
| PFLTSIPALLARPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSHPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVF AWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEDYDKTGKLPDPSSTDNAEFQIVLTLIRYGLKANPSKYRNMKERLVGVSEETTTGV | |||
Physicochemical properties | |||
| Number of amino acids: | 223 | ||
| Molecular weight: | 11,341.075 | ||
| Theoretical pI: | 11.802 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 28990 | ||
| Instability index: | 49.754 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.331 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.280 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335818.1 | 5prime_partial | 214 | 669-25(-) |
Amino Acid sequence : | |||
| HPSSCFLRNTNQSLLHVPILAGIGLQPVSDQRQHYLKLRIIGRAGVRQLPRLIVILLRLHALVDQQSSITAIVHDEVGAAARAPVEGPLRAPPVLLQGLTLPGEDGGAVASNGSGGVVLS GEDVARAPSDLSAESGKGLNEDGSLDGHVETSGDPGALEGMGGAELGPAGNEARHLHLSELDFEAAEVGLGHVLDLVLAAGGGLLHLERHGSSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 11,341.075 | ||
| Theoretical pI: | 11.802 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 28990 | ||
| Instability index: | 49.754 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.331 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.280 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335818.1 | 3prime_partial | 100 | 302-3(-) |
Amino Acid sequence : | |||
| MLQEHHLTSAPRAVRVSMRTAVWMVMWRLPVIRAPLKGWEGPNSVRQEMRPGISTSASSISRRPKSAWDMSLTLYSRPEVVFSTWSAMGRASRAGMDVRN | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,341.075 | ||
| Theoretical pI: | 11.802 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 28990 | ||
| Instability index: | 49.754 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.331 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.280 | ||
| sheet | 0.270 | ||