| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335820.1 | 5prime_partial | 141 | 2-427(+) |
Amino Acid sequence : | |||
| KPPRVLSLISTEIRNLEKLSKDGASMSSSQIPAPVLTAAKVIHKLSLNYVSVSSFSWDQDNDKVKIYLSLEGVDREKTDTDFKPMSFDAKFHDVNGKNYRFSLPKLNKQIVPEKCKVLAK PSRVVITLAKTSKGNWLDLHY* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,892.178 | ||
| Theoretical pI: | 9.593 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 31.358 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.406 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.255 | ||
| sheet | 0.206 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335820.1 | 5prime_partial | 141 | 2-427(+) |
Amino Acid sequence : | |||
| KPPRVLSLISTEIRNLEKLSKDGASMSSSQIPAPVLTAAKVIHKLSLNYVSVSSFSWDQDNDKVKIYLSLEGVDREKTDTDFKPMSFDAKFHDVNGKNYRFSLPKLNKQIVPEKCKVLAK PSRVVITLAKTSKGNWLDLHY* | |||
Physicochemical properties | |||
| Number of amino acids: | 141 | ||
| Molecular weight: | 15,892.178 | ||
| Theoretical pI: | 9.593 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 31.358 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.406 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.255 | ||
| sheet | 0.206 | ||