| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335828.1 | 3prime_partial | 219 | 81-737(+) |
Amino Acid sequence : | |||
| MVKETEYYDVLGVSPTATEAEIKKAYYVKARQVHPDKNPNDPNAAHKFQILGEAYQVLSDPSQRQAYDVNGKSGISTDSIIYPAAIFAMLFGSELFEEYIGQLAMASMASMDVFTEGEEL DTKKLQEKMRAVQREREEKLAGILKDRLNLYVQGNKDEFTRIAEGEVSRLSNAAYGVDMLNTIGYIYARQAAKELGKKVMYLGVPFVAEWFPNKGHFIK | |||
Physicochemical properties | |||
| Number of amino acids: | 219 | ||
| Molecular weight: | 24,669.799 | ||
| Theoretical pI: | 5.545 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24870 24870 | ||
| Instability index: | 33.410 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.396 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.196 | ||
| sheet | 0.306 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335828.1 | 3prime_partial | 219 | 81-737(+) |
Amino Acid sequence : | |||
| MVKETEYYDVLGVSPTATEAEIKKAYYVKARQVHPDKNPNDPNAAHKFQILGEAYQVLSDPSQRQAYDVNGKSGISTDSIIYPAAIFAMLFGSELFEEYIGQLAMASMASMDVFTEGEEL DTKKLQEKMRAVQREREEKLAGILKDRLNLYVQGNKDEFTRIAEGEVSRLSNAAYGVDMLNTIGYIYARQAAKELGKKVMYLGVPFVAEWFPNKGHFIK | |||
Physicochemical properties | |||
| Number of amino acids: | 219 | ||
| Molecular weight: | 24,669.799 | ||
| Theoretical pI: | 5.545 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24870 24870 | ||
| Instability index: | 33.410 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.396 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.196 | ||
| sheet | 0.306 | ||