Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335838.1 | complete | 140 | 602-180(-) |
Amino Acid sequence : | |||
MELKRKTNLVDLLNLGSCTAAAAGGRNIIIHGRLSTRSLVHLCNDRVADALQLLHLVLKLISLRQLVPVQPLNGRLNGILNLLLVGCRELRGDFLVLDGVPHVVGVVLQCILGLHLLLVL LIFRLVFLGFLNHLLNLVLG* | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 13,721.114 | ||
Theoretical pI: | 4.555 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 51.141 | ||
aromaticity | 0.048 | ||
GRAVY | -0.922 | ||
Secondary Structure Fraction | |||
Helix | 0.194 | ||
turn | 0.210 | ||
sheet | 0.347 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335838.1 | complete | 124 | 204-578(+) |
Amino Acid sequence : | |||
MVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDEKIASKLPAADKKKIEDAIESTIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGAGGEAPMDDDVPAPSGGSSAGPKI EEVD* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 13,721.114 | ||
Theoretical pI: | 4.555 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 51.141 | ||
aromaticity | 0.048 | ||
GRAVY | -0.922 | ||
Secondary Structure Fraction | |||
Helix | 0.194 | ||
turn | 0.210 | ||
sheet | 0.347 |