| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335838.1 | complete | 140 | 602-180(-) |
Amino Acid sequence : | |||
| MELKRKTNLVDLLNLGSCTAAAAGGRNIIIHGRLSTRSLVHLCNDRVADALQLLHLVLKLISLRQLVPVQPLNGRLNGILNLLLVGCRELRGDFLVLDGVPHVVGVVLQCILGLHLLLVL LIFRLVFLGFLNHLLNLVLG* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 13,721.114 | ||
| Theoretical pI: | 4.555 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 51.141 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.922 | ||
Secondary Structure Fraction | |||
| Helix | 0.194 | ||
| turn | 0.210 | ||
| sheet | 0.347 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335838.1 | complete | 124 | 204-578(+) |
Amino Acid sequence : | |||
| MVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTVKDEKIASKLPAADKKKIEDAIESTIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGAGGEAPMDDDVPAPSGGSSAGPKI EEVD* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 13,721.114 | ||
| Theoretical pI: | 4.555 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 51.141 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.922 | ||
Secondary Structure Fraction | |||
| Helix | 0.194 | ||
| turn | 0.210 | ||
| sheet | 0.347 | ||