| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335864.1 | 3prime_partial | 230 | 50-739(+) |
Amino Acid sequence : | |||
| MEKKLVQAFVAVILSAAIATRSYRKKSLNFSGALAGFVVMTIHIAVNYRFGALLLVFFVTSSMLTKVGEERKKKVDADFKEGGQRDWIQVFSNSGIATLLVLIAWTQVGMEDFCLNSKES RLMTFLAGGILGHYCCSNGDTWSSELGVLSDDQPRLITNFKPVRKGTNSGVTKAGLITAAAAGSVLGLTFVILGFLTTNCTTSDIAVKQLLVIPVSALAGLCGSVIDSLL | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 24,579.505 | ||
| Theoretical pI: | 9.145 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
| Instability index: | 16.228 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.487 | ||
Secondary Structure Fraction | |||
| Helix | 0.365 | ||
| turn | 0.226 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335864.1 | 3prime_partial | 230 | 50-739(+) |
Amino Acid sequence : | |||
| MEKKLVQAFVAVILSAAIATRSYRKKSLNFSGALAGFVVMTIHIAVNYRFGALLLVFFVTSSMLTKVGEERKKKVDADFKEGGQRDWIQVFSNSGIATLLVLIAWTQVGMEDFCLNSKES RLMTFLAGGILGHYCCSNGDTWSSELGVLSDDQPRLITNFKPVRKGTNSGVTKAGLITAAAAGSVLGLTFVILGFLTTNCTTSDIAVKQLLVIPVSALAGLCGSVIDSLL | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 24,579.505 | ||
| Theoretical pI: | 9.145 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
| Instability index: | 16.228 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.487 | ||
Secondary Structure Fraction | |||
| Helix | 0.365 | ||
| turn | 0.226 | ||
| sheet | 0.270 | ||