| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335871.1 | complete | 148 | 205-651(+) |
Amino Acid sequence : | |||
| MSRVIVLQNTKTPFTYSLGPLLRRSLGHLGSRRVLLLHALDHSNSHRLTHVPHGKPPERGVGREGLHHHGLCRNHLNHTCITVLPSCRIRHEGTGGGPTSGGRRRTALWRVEWRGGASSK CRMRLVFRSRCLCLSTLMEQERSQTRRS* | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 11,763.946 | ||
| Theoretical pI: | 4.675 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27875 | ||
| Instability index: | 29.238 | ||
| aromaticity | 0.104 | ||
| GRAVY | -0.445 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.264 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335871.1 | 3prime_partial | 106 | 410-727(+) |
Amino Acid sequence : | |||
| MGFVGIILIIPASPFFPRAEFGTRGQEGGLHREAGGEQHCGEWNGAEVHRASVVCDWCSGADVCVCRLLWNRKDPRQGDPEDCEGEFRLLAGNDLDQFGSQEGWQW | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,763.946 | ||
| Theoretical pI: | 4.675 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27875 | ||
| Instability index: | 29.238 | ||
| aromaticity | 0.104 | ||
| GRAVY | -0.445 | ||
Secondary Structure Fraction | |||
| Helix | 0.264 | ||
| turn | 0.264 | ||
| sheet | 0.236 | ||