Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335871.1 | complete | 148 | 205-651(+) |
Amino Acid sequence : | |||
MSRVIVLQNTKTPFTYSLGPLLRRSLGHLGSRRVLLLHALDHSNSHRLTHVPHGKPPERGVGREGLHHHGLCRNHLNHTCITVLPSCRIRHEGTGGGPTSGGRRRTALWRVEWRGGASSK CRMRLVFRSRCLCLSTLMEQERSQTRRS* | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 11,763.946 | ||
Theoretical pI: | 4.675 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27875 | ||
Instability index: | 29.238 | ||
aromaticity | 0.104 | ||
GRAVY | -0.445 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.264 | ||
sheet | 0.236 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335871.1 | 3prime_partial | 106 | 410-727(+) |
Amino Acid sequence : | |||
MGFVGIILIIPASPFFPRAEFGTRGQEGGLHREAGGEQHCGEWNGAEVHRASVVCDWCSGADVCVCRLLWNRKDPRQGDPEDCEGEFRLLAGNDLDQFGSQEGWQW | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,763.946 | ||
Theoretical pI: | 4.675 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27875 | ||
Instability index: | 29.238 | ||
aromaticity | 0.104 | ||
GRAVY | -0.445 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.264 | ||
sheet | 0.236 |