Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335883.1 | internal | 153 | 1-459(+) |
Amino Acid sequence : | |||
RRPPLSVRCSTDSSLPATVESSDFDAKGFRHNFMRRKDYNRKGFGHEEESLQRISRQYASENIIQKLRENGNEYRWGEVSVKLAEAYGLCWGVERALRIAYEARKQFPTQNIWLTSEIIR NPTVNQRLKEMGVNILPVKDGQKQFDLVREGDV | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 15,829.298 | ||
Theoretical pI: | 9.105 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 59.400 | ||
aromaticity | 0.107 | ||
GRAVY | 0.343 | ||
Secondary Structure Fraction | |||
Helix | 0.400 | ||
turn | 0.250 | ||
sheet | 0.243 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335883.1 | 5prime_partial | 140 | 459-37(-) |
Amino Acid sequence : | |||
HIALSDQIKLFLAILHWKNVHSHLLQPLIDSGVANDFTGEPNILSWKLLSGFISNSKSAFNTPAQSISFSQLHAHFSPSVLIPILPQFLDYILACILATYSLETFLLMPKPLSVVIFSSH KIVTEAFSIEIRRFNCRRQR* | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 15,829.298 | ||
Theoretical pI: | 9.105 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 59.400 | ||
aromaticity | 0.107 | ||
GRAVY | 0.343 | ||
Secondary Structure Fraction | |||
Helix | 0.400 | ||
turn | 0.250 | ||
sheet | 0.243 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335883.1 | internal | 153 | 1-459(+) |
Amino Acid sequence : | |||
RRPPLSVRCSTDSSLPATVESSDFDAKGFRHNFMRRKDYNRKGFGHEEESLQRISRQYASENIIQKLRENGNEYRWGEVSVKLAEAYGLCWGVERALRIAYEARKQFPTQNIWLTSEIIR NPTVNQRLKEMGVNILPVKDGQKQFDLVREGDV | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 15,829.298 | ||
Theoretical pI: | 9.105 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 59.400 | ||
aromaticity | 0.107 | ||
GRAVY | 0.343 | ||
Secondary Structure Fraction | |||
Helix | 0.400 | ||
turn | 0.250 | ||
sheet | 0.243 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335883.1 | 5prime_partial | 140 | 459-37(-) |
Amino Acid sequence : | |||
HIALSDQIKLFLAILHWKNVHSHLLQPLIDSGVANDFTGEPNILSWKLLSGFISNSKSAFNTPAQSISFSQLHAHFSPSVLIPILPQFLDYILACILATYSLETFLLMPKPLSVVIFSSH KIVTEAFSIEIRRFNCRRQR* | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 15,829.298 | ||
Theoretical pI: | 9.105 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 59.400 | ||
aromaticity | 0.107 | ||
GRAVY | 0.343 | ||
Secondary Structure Fraction | |||
Helix | 0.400 | ||
turn | 0.250 | ||
sheet | 0.243 |