Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335896.1 | 3prime_partial | 234 | 54-755(+) |
Amino Acid sequence : | |||
MESAALSQIGLAGLAVMGQNLALNIAEKGFPISVFNRTASKVDETLDRAHREGQLPLTGHYTPKDFVLSLKKPRSVIILVKAGAPVDQTIAALSAYMEPGDTIIDGGNEWYENTERRMVD AAANGLLYLGMGVSGGEDGARNGPSLMPGGSHRAYLNIHNILDKIAAQVDDGPCVTYIGEGGSGNFVKMVHNGIEYGDMQLISEAYDVLKNVGGLSNDELAEIFREWNRGELES | |||
Physicochemical properties | |||
Number of amino acids: | 234 | ||
Molecular weight: | 25,064.984 | ||
Theoretical pI: | 4.808 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
Instability index: | 30.350 | ||
aromaticity | 0.064 | ||
GRAVY | -0.173 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.282 | ||
sheet | 0.299 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335896.1 | 3prime_partial | 234 | 54-755(+) |
Amino Acid sequence : | |||
MESAALSQIGLAGLAVMGQNLALNIAEKGFPISVFNRTASKVDETLDRAHREGQLPLTGHYTPKDFVLSLKKPRSVIILVKAGAPVDQTIAALSAYMEPGDTIIDGGNEWYENTERRMVD AAANGLLYLGMGVSGGEDGARNGPSLMPGGSHRAYLNIHNILDKIAAQVDDGPCVTYIGEGGSGNFVKMVHNGIEYGDMQLISEAYDVLKNVGGLSNDELAEIFREWNRGELES | |||
Physicochemical properties | |||
Number of amino acids: | 234 | ||
Molecular weight: | 25,064.984 | ||
Theoretical pI: | 4.808 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
Instability index: | 30.350 | ||
aromaticity | 0.064 | ||
GRAVY | -0.173 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.282 | ||
sheet | 0.299 |