| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335896.1 | 3prime_partial | 234 | 54-755(+) |
Amino Acid sequence : | |||
| MESAALSQIGLAGLAVMGQNLALNIAEKGFPISVFNRTASKVDETLDRAHREGQLPLTGHYTPKDFVLSLKKPRSVIILVKAGAPVDQTIAALSAYMEPGDTIIDGGNEWYENTERRMVD AAANGLLYLGMGVSGGEDGARNGPSLMPGGSHRAYLNIHNILDKIAAQVDDGPCVTYIGEGGSGNFVKMVHNGIEYGDMQLISEAYDVLKNVGGLSNDELAEIFREWNRGELES | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 25,064.984 | ||
| Theoretical pI: | 4.808 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
| Instability index: | 30.350 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.173 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.282 | ||
| sheet | 0.299 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335896.1 | 3prime_partial | 234 | 54-755(+) |
Amino Acid sequence : | |||
| MESAALSQIGLAGLAVMGQNLALNIAEKGFPISVFNRTASKVDETLDRAHREGQLPLTGHYTPKDFVLSLKKPRSVIILVKAGAPVDQTIAALSAYMEPGDTIIDGGNEWYENTERRMVD AAANGLLYLGMGVSGGEDGARNGPSLMPGGSHRAYLNIHNILDKIAAQVDDGPCVTYIGEGGSGNFVKMVHNGIEYGDMQLISEAYDVLKNVGGLSNDELAEIFREWNRGELES | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 25,064.984 | ||
| Theoretical pI: | 4.808 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 22920 | ||
| Instability index: | 30.350 | ||
| aromaticity | 0.064 | ||
| GRAVY | -0.173 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.282 | ||
| sheet | 0.299 | ||