Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335912.1 | 3prime_partial | 144 | 341-772(+) |
Amino Acid sequence : | |||
MEVATDELYTPIKQDTKKGKLRYYPYNINWNYGLLPQTWEDPSFSNAEVDGAFGDNDPVDVVEIGESRGKIGQVLKVKPLAALAMIDEGELDWKIVAISLDDPTASLVNDVDDVEKHFPG TLTAIRDWFRDYKIPDGKPANKFG | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 11,501.195 | ||
Theoretical pI: | 8.811 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
Instability index: | 33.306 | ||
aromaticity | 0.131 | ||
GRAVY | 0.089 | ||
Secondary Structure Fraction | |||
Helix | 0.404 | ||
turn | 0.273 | ||
sheet | 0.131 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335912.1 | complete | 109 | 159-488(+) |
Amino Acid sequence : | |||
MPYTTPNFKSRKRATPKPLITASSSSITRAKRFPPGMIYHFTWVMVYSISSSRFQRNQVQRWKLLQMSCTLPLSRIPRRENSDTTRTTLTGTMDCFHKHGKTLHFQMLK* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 11,501.195 | ||
Theoretical pI: | 8.811 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
Instability index: | 33.306 | ||
aromaticity | 0.131 | ||
GRAVY | 0.089 | ||
Secondary Structure Fraction | |||
Helix | 0.404 | ||
turn | 0.273 | ||
sheet | 0.131 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335912.1 | 5prime_partial | 99 | 772-473(-) |
Amino Acid sequence : | |||
AKFVGRFSIRYLVVSEPVPDCSKSSWEMLLNIVDIIDKGSRWIIQRNSNNFPVKFSLINHCQCRQGLHFQDLPNLTSAFSNLDYINWIVISKCTIYFSI* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,501.195 | ||
Theoretical pI: | 8.811 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
Instability index: | 33.306 | ||
aromaticity | 0.131 | ||
GRAVY | 0.089 | ||
Secondary Structure Fraction | |||
Helix | 0.404 | ||
turn | 0.273 | ||
sheet | 0.131 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335912.1 | 3prime_partial | 144 | 341-772(+) |
Amino Acid sequence : | |||
MEVATDELYTPIKQDTKKGKLRYYPYNINWNYGLLPQTWEDPSFSNAEVDGAFGDNDPVDVVEIGESRGKIGQVLKVKPLAALAMIDEGELDWKIVAISLDDPTASLVNDVDDVEKHFPG TLTAIRDWFRDYKIPDGKPANKFG | |||
Physicochemical properties | |||
Number of amino acids: | 144 | ||
Molecular weight: | 11,501.195 | ||
Theoretical pI: | 8.811 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
Instability index: | 33.306 | ||
aromaticity | 0.131 | ||
GRAVY | 0.089 | ||
Secondary Structure Fraction | |||
Helix | 0.404 | ||
turn | 0.273 | ||
sheet | 0.131 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335912.1 | complete | 109 | 159-488(+) |
Amino Acid sequence : | |||
MPYTTPNFKSRKRATPKPLITASSSSITRAKRFPPGMIYHFTWVMVYSISSSRFQRNQVQRWKLLQMSCTLPLSRIPRRENSDTTRTTLTGTMDCFHKHGKTLHFQMLK* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 11,501.195 | ||
Theoretical pI: | 8.811 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
Instability index: | 33.306 | ||
aromaticity | 0.131 | ||
GRAVY | 0.089 | ||
Secondary Structure Fraction | |||
Helix | 0.404 | ||
turn | 0.273 | ||
sheet | 0.131 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335912.1 | 5prime_partial | 99 | 772-473(-) |
Amino Acid sequence : | |||
AKFVGRFSIRYLVVSEPVPDCSKSSWEMLLNIVDIIDKGSRWIIQRNSNNFPVKFSLINHCQCRQGLHFQDLPNLTSAFSNLDYINWIVISKCTIYFSI* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,501.195 | ||
Theoretical pI: | 8.811 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
Instability index: | 33.306 | ||
aromaticity | 0.131 | ||
GRAVY | 0.089 | ||
Secondary Structure Fraction | |||
Helix | 0.404 | ||
turn | 0.273 | ||
sheet | 0.131 |