| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335925.1 | internal | 137 | 1-411(+) |
Amino Acid sequence : | |||
| APRKAYNSQKLNMANPFYHLLLQYCFLFCREAPYKSFARNATSAPATDYYDYIVIGGGTAGCPLAATLSAAGKVLLLERGGLPYDNPNVMSTTGFTNSLTDVSDASAAQLFVSNDGVYNH RGGVLGGGSAVNAGFYS | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 14,479.076 | ||
| Theoretical pI: | 7.917 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14900 15025 | ||
| Instability index: | 35.858 | ||
| aromaticity | 0.124 | ||
| GRAVY | -0.026 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.314 | ||
| sheet | 0.263 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335925.1 | internal | 137 | 1-411(+) |
Amino Acid sequence : | |||
| APRKAYNSQKLNMANPFYHLLLQYCFLFCREAPYKSFARNATSAPATDYYDYIVIGGGTAGCPLAATLSAAGKVLLLERGGLPYDNPNVMSTTGFTNSLTDVSDASAAQLFVSNDGVYNH RGGVLGGGSAVNAGFYS | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 14,479.076 | ||
| Theoretical pI: | 7.917 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14900 15025 | ||
| Instability index: | 35.858 | ||
| aromaticity | 0.124 | ||
| GRAVY | -0.026 | ||
Secondary Structure Fraction | |||
| Helix | 0.299 | ||
| turn | 0.314 | ||
| sheet | 0.263 | ||