| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335929.1 | complete | 140 | 85-507(+) |
Amino Acid sequence : | |||
| MMLATTSLVGILGHPITKHDFDWITNEPRILQAASVICRLMDDVVGHGIEQKISSVDCFMKENGCSKMEAVAEFSKRVKKAWKNLNEEWVEPREASMVILERVVNLARVINLLYVGEDAY GNSRGKTKEFIKAVLVHPIK* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,428.695 | ||
| Theoretical pI: | 9.401 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 52.678 | ||
| aromaticity | 0.122 | ||
| GRAVY | 0.284 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.266 | ||
| sheet | 0.180 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335929.1 | complete | 139 | 500-81(-) |
Amino Acid sequence : | |||
| MGCTSTALINSLVLPLEFPYASSPTYNRFITRARFTTRSRITILASLGSTHSSFKFFHAFFTRFENSATASIFEHPFSFMKQSTLDIFCSIPWPTTSSINLQITDAACKIRGSFVIQSKS CLVIGCPNIPTKEVVANII* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 15,428.695 | ||
| Theoretical pI: | 9.401 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 52.678 | ||
| aromaticity | 0.122 | ||
| GRAVY | 0.284 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.266 | ||
| sheet | 0.180 | ||