Acc_NO	ORF type	length	start-end position (strand +/-)
>DY335935.1	5prime_partial	167	1-504(+)
Amino Acid sequence :
KLVQTKRDITLMAVITDEMRTAASEIYHGDEICQEKSKFLLTEVGLPNGLLPLKDIVECGYIKETGFVWLIQKEKTEHKFEKIGKLVQYATEVTAYVEPGRIRKLTGVKAKELLLWVGLT DINMDSTTAKITFKSIAGLSRTFPVDAFVVEEKVKTTAASGDLVKEV*
Physicochemical properties
Number of amino acids:		167
Molecular weight:		18,650.549
Theoretical pI:		6.946
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16960 17085
Instability index:		26.283
aromaticity		0.072
GRAVY		-0.056
Secondary Structure Fraction
Helix		0.341
turn		0.138
sheet		0.281