Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335943.1 | complete | 152 | 58-516(+) |
Amino Acid sequence : | |||
MSLVANEDFQHILRVQNTNVDGKQKIMFAMTSIKGIGRRFANIVCKKADIDMNKRAGELSAAEIDSLMVIVANPRQFKIPDWFLNRKKDYKDGKFSQVTSNALDMKLRDDLERLKKIRNH RGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR* | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 17,569.273 | ||
Theoretical pI: | 10.650 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 13980 | ||
Instability index: | 31.086 | ||
aromaticity | 0.066 | ||
GRAVY | -0.703 | ||
Secondary Structure Fraction | |||
Helix | 0.270 | ||
turn | 0.191 | ||
sheet | 0.197 |