| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335952.1 | internal | 251 | 3-755(+) |
Amino Acid sequence : | |||
| TPFADILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQAMPVTRSPAGLSGEALKTGTSLYLKSIRGEDSWSDPAYGYHMKAFTNAM IAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSDNKCIEILKTCKEAIPASTGKVMIVDA IINEDGKGDEF | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 11,288.719 | ||
| Theoretical pI: | 11.174 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 69.992 | ||
| aromaticity | 0.030 | ||
| GRAVY | -0.774 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.270 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335952.1 | 5prime_partial | 125 | 755-378(-) |
Amino Acid sequence : | |||
| KLVAFSIFVNYSIYNHHFSGTRWNRFFACLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLHQSPDSRSVAAAHIHHRSQSVKRRRIVAY NGSRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 11,288.719 | ||
| Theoretical pI: | 11.174 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 69.992 | ||
| aromaticity | 0.030 | ||
| GRAVY | -0.774 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.270 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335952.1 | 5prime_partial | 116 | 754-404(-) |
Amino Acid sequence : | |||
| NSSPFPSSLIIASTIITFPVLAGIASLHVFRISMHLLSLQSCNIHMSMTASAFGTLSNMSPPTKSTPLRGGASATISGRSNAIPRTHGNASTSLPIAVPWRPPTSTTDRNPSNAAG* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 11,288.719 | ||
| Theoretical pI: | 11.174 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 69.992 | ||
| aromaticity | 0.030 | ||
| GRAVY | -0.774 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.270 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335952.1 | 3prime_partial | 112 | 338-3(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRHRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQGHQAAVIFQDVGKRG | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 11,288.719 | ||
| Theoretical pI: | 11.174 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 69.992 | ||
| aromaticity | 0.030 | ||
| GRAVY | -0.774 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.270 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335952.1 | 5prime_partial | 100 | 2-304(+) |
Amino Acid sequence : | |||
| HPFCRHPGRSRRPDVPVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGDKPLSQVDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,288.719 | ||
| Theoretical pI: | 11.174 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 69.992 | ||
| aromaticity | 0.030 | ||
| GRAVY | -0.774 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.270 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335952.1 | internal | 251 | 3-755(+) |
Amino Acid sequence : | |||
| TPFADILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQAMPVTRSPAGLSGEALKTGTSLYLKSIRGEDSWSDPAYGYHMKAFTNAM IAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSDNKCIEILKTCKEAIPASTGKVMIVDA IINEDGKGDEF | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 11,288.719 | ||
| Theoretical pI: | 11.174 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 69.992 | ||
| aromaticity | 0.030 | ||
| GRAVY | -0.774 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.270 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335952.1 | 5prime_partial | 125 | 755-378(-) |
Amino Acid sequence : | |||
| KLVAFSIFVNYSIYNHHFSGTRWNRFFACLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLHQSPDSRSVAAAHIHHRSQSVKRRRIVAY NGSRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 11,288.719 | ||
| Theoretical pI: | 11.174 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 69.992 | ||
| aromaticity | 0.030 | ||
| GRAVY | -0.774 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.270 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335952.1 | 5prime_partial | 116 | 754-404(-) |
Amino Acid sequence : | |||
| NSSPFPSSLIIASTIITFPVLAGIASLHVFRISMHLLSLQSCNIHMSMTASAFGTLSNMSPPTKSTPLRGGASATISGRSNAIPRTHGNASTSLPIAVPWRPPTSTTDRNPSNAAG* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 11,288.719 | ||
| Theoretical pI: | 11.174 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 69.992 | ||
| aromaticity | 0.030 | ||
| GRAVY | -0.774 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.270 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335952.1 | 3prime_partial | 112 | 338-3(-) |
Amino Acid sequence : | |||
| MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRHRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQGHQAAVIFQDVGKRG | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 11,288.719 | ||
| Theoretical pI: | 11.174 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 69.992 | ||
| aromaticity | 0.030 | ||
| GRAVY | -0.774 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.270 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335952.1 | 5prime_partial | 100 | 2-304(+) |
Amino Acid sequence : | |||
| HPFCRHPGRSRRPDVPVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGDKPLSQVDQR* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 11,288.719 | ||
| Theoretical pI: | 11.174 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 69.992 | ||
| aromaticity | 0.030 | ||
| GRAVY | -0.774 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.270 | ||
| sheet | 0.260 | ||