Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335958.1 | 3prime_partial | 177 | 77-607(+) |
Amino Acid sequence : | |||
MAKEVSHGENHTSMKPPPEPSPLRKAKFFQANMRILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVTEPLLVEVDQIYHLACPASPIFYKYNPVKT IKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLVHPQDESYWGNVNPIGVRSCYD | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 19,887.643 | ||
Theoretical pI: | 7.809 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
Instability index: | 34.158 | ||
aromaticity | 0.085 | ||
GRAVY | -0.297 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.266 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335958.1 | 3prime_partial | 177 | 77-607(+) |
Amino Acid sequence : | |||
MAKEVSHGENHTSMKPPPEPSPLRKAKFFQANMRILVTGGAGFIGSHLVDKLMENEKNEVIVVDNYFTGSKDNLRKWIGHPRFELIRHDVTEPLLVEVDQIYHLACPASPIFYKYNPVKT IKTNVIGTLNMLGLAKRVGARILLTSTSEVYGDPLVHPQDESYWGNVNPIGVRSCYD | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 19,887.643 | ||
Theoretical pI: | 7.809 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
Instability index: | 34.158 | ||
aromaticity | 0.085 | ||
GRAVY | -0.297 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.266 | ||
sheet | 0.220 |