Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335960.1 | 5prime_partial | 196 | 640-50(-) |
Amino Acid sequence : | |||
QKVIFKLCFTNLIYHLQTSNSKMLIQNIKIDSNISKFWDDYIVNSPKTIKQYKNSTTSELSSFILLASQTSKLVSDNNIKLGGPFNNFFPLSRGNIVCDFCTIFSIVHHEQLKLFDIVHK KLLEAVWKIMSGLLVRAITNVGHKNGSFKLPPDPRINTLGSTPVCLDGNKAIALGPLEFLHPLLDNPLIEKWHRHC* | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 17,764.666 | ||
Theoretical pI: | 10.818 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 52.884 | ||
aromaticity | 0.060 | ||
GRAVY | -0.785 | ||
Secondary Structure Fraction | |||
Helix | 0.285 | ||
turn | 0.185 | ||
sheet | 0.205 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335960.1 | 5prime_partial | 151 | 2-457(+) |
Amino Acid sequence : | |||
HPVGAEHKTLISHRNPLTMAVPLLDKRIIKKRVKKFKRTQSDRFVSVKTNWRRPKGIDSRVRRKFKGSVLMPNIGYGSDKKTRHYLPNGFKKFLVHNVKELELLMMHNRKYCAEIAHNVS TRKRKEIVERATQLDVVVTNKLARLRSQEDE* | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 17,764.666 | ||
Theoretical pI: | 10.818 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 52.884 | ||
aromaticity | 0.060 | ||
GRAVY | -0.785 | ||
Secondary Structure Fraction | |||
Helix | 0.285 | ||
turn | 0.185 | ||
sheet | 0.205 |