Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335966.1 | 5prime_partial | 233 | 2-703(+) |
Amino Acid sequence : | |||
HPLKALELLHNVVTALMTIISAIAVEAYKKYILVSLIHHGQFATSFPKYTSAAAQRNLKNFSQPYIELVNSYSTGKVSELEKCVQANRDKFESDKNLGLVKQVVSSMYKRNIQRLTQTYL TLSLQDIANTVQLNSPKEAEMHVLQMIQEGEIYATINQKDGMVRFLEDPEQYKTCEMIEHLDFSIQRIMMLSKKLTTMNENMSCDAIYLGKVGRERQKFDFEDFDTVPSKFNI* | |||
Physicochemical properties | |||
Number of amino acids: | 233 | ||
Molecular weight: | 26,774.574 | ||
Theoretical pI: | 7.169 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14900 15025 | ||
Instability index: | 39.946 | ||
aromaticity | 0.086 | ||
GRAVY | -0.294 | ||
Secondary Structure Fraction | |||
Helix | 0.318 | ||
turn | 0.185 | ||
sheet | 0.275 |