Acc_NO	ORF type	length	start-end position (strand +/-)
>DY335970.1	5prime_partial	199	3-602(+)
Amino Acid sequence :
TPLRGARRATAAMGIVLVAGGKVKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSRFNAVVLKRLFMSRINRPPLSLSRLSALMKGKEDKIAVLVGSVTDDVRAHDIPAIKVTALRFTERA RARIEKAGGECLTFDQLALRAPLGQNTVLLRGSRNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGKRNSRGFRV*
Physicochemical properties
Number of amino acids:		199
Molecular weight:		22,116.839
Theoretical pI:		11.831
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		4470 4470
Instability index:		37.925
aromaticity		0.055
GRAVY		-0.355
Secondary Structure Fraction
Helix		0.281
turn		0.216
sheet		0.256