| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335975.1 | 3prime_partial | 220 | 114-773(+) |
Amino Acid sequence : | |||
| MFIPDPMAGFAFIYMEDERDAEDAIRKLDRIEFGRKGRRLRVEWTKQERGGRRSDSSRRSSANLKPSKTLFVINFDPVNTRTRDIERHFEHYGKISNVRIRRNFAFVQYESQEDATRALE AANMSKLMDRVISVEYATRDDDDDKRNGYSPDNRRGRDGSPDGRGYGRGGRSPSPYQRERGSPDYGHGAAPNSRPERRNSPDYGRAASPANDSYKNRSPP | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 25,314.497 | ||
| Theoretical pI: | 9.839 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20400 | ||
| Instability index: | 70.819 | ||
| aromaticity | 0.091 | ||
| GRAVY | -1.317 | ||
Secondary Structure Fraction | |||
| Helix | 0.191 | ||
| turn | 0.295 | ||
| sheet | 0.186 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335975.1 | 3prime_partial | 220 | 114-773(+) |
Amino Acid sequence : | |||
| MFIPDPMAGFAFIYMEDERDAEDAIRKLDRIEFGRKGRRLRVEWTKQERGGRRSDSSRRSSANLKPSKTLFVINFDPVNTRTRDIERHFEHYGKISNVRIRRNFAFVQYESQEDATRALE AANMSKLMDRVISVEYATRDDDDDKRNGYSPDNRRGRDGSPDGRGYGRGGRSPSPYQRERGSPDYGHGAAPNSRPERRNSPDYGRAASPANDSYKNRSPP | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 25,314.497 | ||
| Theoretical pI: | 9.839 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20400 20400 | ||
| Instability index: | 70.819 | ||
| aromaticity | 0.091 | ||
| GRAVY | -1.317 | ||
Secondary Structure Fraction | |||
| Helix | 0.191 | ||
| turn | 0.295 | ||
| sheet | 0.186 | ||