Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335978.1 | complete | 102 | 320-628(+) |
Amino Acid sequence : | |||
MLGNVNTSSALSAFEKMEEKVLAMESQSEALNQLTSDELEGKFALLETSSVDDDLADLKKELSGSTKKGELPPGRPVAAALKYQDPEIEKELNELRQKAKEY* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,217.456 | ||
Theoretical pI: | 4.565 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
Instability index: | 41.550 | ||
aromaticity | 0.039 | ||
GRAVY | -0.663 | ||
Secondary Structure Fraction | |||
Helix | 0.235 | ||
turn | 0.225 | ||
sheet | 0.422 |