| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335998.1 | 5prime_partial | 196 | 3-593(+) |
Amino Acid sequence : | |||
| PAFLLWESMGGLLTMLMYFQSAEEDLWTGLIFSAPLFVFPEPMVPSKVHIFMYGLLFGLADTWAAMPDNKMVGKAIKDPEKLKVIASNPMRYTGKPRVGTMRELVRQTDYVQRNFDKVKA PFLTLHGTSDGLAEASGSEMLYQKASSEDKTLKLYEGMYHSLVQGEPDENANLVLADMRAWIDARVERYGSNCSAN* | |||
Physicochemical properties | |||
| Number of amino acids: | 196 | ||
| Molecular weight: | 19,729.955 | ||
| Theoretical pI: | 10.042 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 55.310 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.075 | ||
Secondary Structure Fraction | |||
| Helix | 0.366 | ||
| turn | 0.238 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335998.1 | 5prime_partial | 172 | 683-165(-) |
Amino Acid sequence : | |||
| KKFFFIIFKYEEYIKENLGCVKNQPMLREWLICTTVGTISLNSSINPSPHISQHKISILIRLTLHQRVIHPFIQFQSLVLTAGLLVQHLRPRRLSQPIRGPVQSQEGRLDLVEIPLHVIR LPHQLPHRPHSGLPGVPHRVARDHLQLLGIFDGLPHHLVVRHCSPCVGQSEQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 19,729.955 | ||
| Theoretical pI: | 10.042 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 55.310 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.075 | ||
Secondary Structure Fraction | |||
| Helix | 0.366 | ||
| turn | 0.238 | ||
| sheet | 0.198 | ||