| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336000.1 | internal | 210 | 1-630(+) |
Amino Acid sequence : | |||
| PVRAVKMEAKSNTDLYAEVEIWKYVLGFTPMAAVKCAVDLKIPDILESHGGAMSHSELASAVGCSPSALRHVMRYLVHRGFFKQEESTSYKLTPLSRLLLQNGGNKINESVIPLFLLQSS PEMLAPWQWLTSRLSMKKTPAPFEAARGQEMWEYTSKNPAFSKLFYEAMSAHARQAVSEILDRYPQVFEGIGSLVDVGGADGTAISAIVK | |||
Physicochemical properties | |||
| Number of amino acids: | 210 | ||
| Molecular weight: | 11,340.922 | ||
| Theoretical pI: | 11.468 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 75.789 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.723 | ||
Secondary Structure Fraction | |||
| Helix | 0.214 | ||
| turn | 0.379 | ||
| sheet | 0.175 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336000.1 | 5prime_partial | 103 | 3-314(+) |
Amino Acid sequence : | |||
| RKGRENGSEIKYGPLCGGRNMEVCVGLHSNGRSQVCSRPQNTRHPGKSRRRHVSFGAGLCRRVLSLRPPPCNEILGPPRFLQAGGIHLLQTNSSFPSAPAKRW* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,340.922 | ||
| Theoretical pI: | 11.468 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 75.789 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.723 | ||
Secondary Structure Fraction | |||
| Helix | 0.214 | ||
| turn | 0.379 | ||
| sheet | 0.175 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336000.1 | internal | 210 | 1-630(+) |
Amino Acid sequence : | |||
| PVRAVKMEAKSNTDLYAEVEIWKYVLGFTPMAAVKCAVDLKIPDILESHGGAMSHSELASAVGCSPSALRHVMRYLVHRGFFKQEESTSYKLTPLSRLLLQNGGNKINESVIPLFLLQSS PEMLAPWQWLTSRLSMKKTPAPFEAARGQEMWEYTSKNPAFSKLFYEAMSAHARQAVSEILDRYPQVFEGIGSLVDVGGADGTAISAIVK | |||
Physicochemical properties | |||
| Number of amino acids: | 210 | ||
| Molecular weight: | 11,340.922 | ||
| Theoretical pI: | 11.468 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 75.789 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.723 | ||
Secondary Structure Fraction | |||
| Helix | 0.214 | ||
| turn | 0.379 | ||
| sheet | 0.175 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336000.1 | 5prime_partial | 103 | 3-314(+) |
Amino Acid sequence : | |||
| RKGRENGSEIKYGPLCGGRNMEVCVGLHSNGRSQVCSRPQNTRHPGKSRRRHVSFGAGLCRRVLSLRPPPCNEILGPPRFLQAGGIHLLQTNSSFPSAPAKRW* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,340.922 | ||
| Theoretical pI: | 11.468 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7240 | ||
| Instability index: | 75.789 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.723 | ||
Secondary Structure Fraction | |||
| Helix | 0.214 | ||
| turn | 0.379 | ||
| sheet | 0.175 | ||