Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336001.1 | 5prime_partial | 214 | 742-98(-) |
Amino Acid sequence : | |||
PAPLEAARGQEMWEYTSKNPAFSKLFYEAMSAHARQAVSEILDRYPQVFEGIGSLVDVGGADGTAISAIVKGCPWIRGINFDLPHVAAAAPRREGVEHVGGNMFEQVPRADAVFTMCALH DWSDEECVEILKECKEAIPKETGKVIIVEVVIKEGEEDKFVDVNLALDMAMLAFTDTGKERTTKEWEYVVNKAGFSRYTITHAGVILSVIEAYP* | |||
Physicochemical properties | |||
Number of amino acids: | 214 | ||
Molecular weight: | 12,957.864 | ||
Theoretical pI: | 9.559 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 47.383 | ||
aromaticity | 0.064 | ||
GRAVY | 0.494 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.320 | ||
sheet | 0.216 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336001.1 | complete | 125 | 114-491(+) |
Amino Acid sequence : | |||
MTDKITPACVIVYLLKPALFTTYSHSLVVLSFPVSVKANIAISNAKLTSTNLSSSPSLITTSTIITFPVSFGIASLHSFSISTHSSSLQSCSAHMVKTASALGTCSNMFPPTCSTPSRRG AAAAT* | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 12,957.864 | ||
Theoretical pI: | 9.559 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 47.383 | ||
aromaticity | 0.064 | ||
GRAVY | 0.494 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.320 | ||
sheet | 0.216 |