| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336001.1 | 5prime_partial | 214 | 742-98(-) |
Amino Acid sequence : | |||
| PAPLEAARGQEMWEYTSKNPAFSKLFYEAMSAHARQAVSEILDRYPQVFEGIGSLVDVGGADGTAISAIVKGCPWIRGINFDLPHVAAAAPRREGVEHVGGNMFEQVPRADAVFTMCALH DWSDEECVEILKECKEAIPKETGKVIIVEVVIKEGEEDKFVDVNLALDMAMLAFTDTGKERTTKEWEYVVNKAGFSRYTITHAGVILSVIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 214 | ||
| Molecular weight: | 12,957.864 | ||
| Theoretical pI: | 9.559 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 47.383 | ||
| aromaticity | 0.064 | ||
| GRAVY | 0.494 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.320 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336001.1 | complete | 125 | 114-491(+) |
Amino Acid sequence : | |||
| MTDKITPACVIVYLLKPALFTTYSHSLVVLSFPVSVKANIAISNAKLTSTNLSSSPSLITTSTIITFPVSFGIASLHSFSISTHSSSLQSCSAHMVKTASALGTCSNMFPPTCSTPSRRG AAAAT* | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 12,957.864 | ||
| Theoretical pI: | 9.559 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 47.383 | ||
| aromaticity | 0.064 | ||
| GRAVY | 0.494 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.320 | ||
| sheet | 0.216 | ||