Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336004.1 | 5prime_partial | 156 | 2-472(+) |
Amino Acid sequence : | |||
PYGYLFELLQRGPTPEPLCQVMLRVGDLDRSIKFYEKALGMRLLKKTDRAEQKYTVAMMGYADEYETTVLELTYNYGVTEYTKGNAYAQVAISTDDVYKSAEAVNLVTQELGGKITRQPG PIPGINTKITSFLDPDGWKTVLVDNADFLKELEANQ* | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 17,544.748 | ||
Theoretical pI: | 4.830 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21890 21890 | ||
Instability index: | 11.717 | ||
aromaticity | 0.103 | ||
GRAVY | -0.380 | ||
Secondary Structure Fraction | |||
Helix | 0.321 | ||
turn | 0.192 | ||
sheet | 0.282 |