| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336004.1 | 5prime_partial | 156 | 2-472(+) |
Amino Acid sequence : | |||
| PYGYLFELLQRGPTPEPLCQVMLRVGDLDRSIKFYEKALGMRLLKKTDRAEQKYTVAMMGYADEYETTVLELTYNYGVTEYTKGNAYAQVAISTDDVYKSAEAVNLVTQELGGKITRQPG PIPGINTKITSFLDPDGWKTVLVDNADFLKELEANQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 156 | ||
| Molecular weight: | 17,544.748 | ||
| Theoretical pI: | 4.830 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21890 21890 | ||
| Instability index: | 11.717 | ||
| aromaticity | 0.103 | ||
| GRAVY | -0.380 | ||
Secondary Structure Fraction | |||
| Helix | 0.321 | ||
| turn | 0.192 | ||
| sheet | 0.282 | ||