| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336005.1 | 3prime_partial | 204 | 99-710(+) |
Amino Acid sequence : | |||
| MEELTRMSTDELLEHRRLKFRAIGLGGFREGSEVEPERKRNMKASEVNAPRFSDIESELDDIKKAILESKGPSDPITNQRLEKLEEDLDREMTKALISMGLNDRIESLNLELAKSPDPDK AMNQGLKEKADKIVQEIKRNLSRPGAYIGLKQKLQTVNMASKLLRLKENSEKLKGQLNQKLSTDVKQRMETLKWAKENLSRGDP | |||
Physicochemical properties | |||
| Number of amino acids: | 204 | ||
| Molecular weight: | 10,372.735 | ||
| Theoretical pI: | 7.741 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 59.498 | ||
| aromaticity | 0.050 | ||
| GRAVY | 0.142 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.420 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336005.1 | complete | 100 | 325-23(-) |
Amino Acid sequence : | |||
| MGSDGPFDSSIAFLMSSSSDSMSENLGAFTSEAFMLRFLSGSTSEPSLKPPRPIARNLSLLCSSSSSVLILVNSSICCKIASLILRDAHTGSKGAPPRGS* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 10,372.735 | ||
| Theoretical pI: | 7.741 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 59.498 | ||
| aromaticity | 0.050 | ||
| GRAVY | 0.142 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.420 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336005.1 | 3prime_partial | 204 | 99-710(+) |
Amino Acid sequence : | |||
| MEELTRMSTDELLEHRRLKFRAIGLGGFREGSEVEPERKRNMKASEVNAPRFSDIESELDDIKKAILESKGPSDPITNQRLEKLEEDLDREMTKALISMGLNDRIESLNLELAKSPDPDK AMNQGLKEKADKIVQEIKRNLSRPGAYIGLKQKLQTVNMASKLLRLKENSEKLKGQLNQKLSTDVKQRMETLKWAKENLSRGDP | |||
Physicochemical properties | |||
| Number of amino acids: | 204 | ||
| Molecular weight: | 10,372.735 | ||
| Theoretical pI: | 7.741 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 59.498 | ||
| aromaticity | 0.050 | ||
| GRAVY | 0.142 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.420 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336005.1 | complete | 100 | 325-23(-) |
Amino Acid sequence : | |||
| MGSDGPFDSSIAFLMSSSSDSMSENLGAFTSEAFMLRFLSGSTSEPSLKPPRPIARNLSLLCSSSSSVLILVNSSICCKIASLILRDAHTGSKGAPPRGS* | |||
Physicochemical properties | |||
| Number of amino acids: | 100 | ||
| Molecular weight: | 10,372.735 | ||
| Theoretical pI: | 7.741 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 59.498 | ||
| aromaticity | 0.050 | ||
| GRAVY | 0.142 | ||
Secondary Structure Fraction | |||
| Helix | 0.250 | ||
| turn | 0.420 | ||
| sheet | 0.260 | ||