| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336011.1 | internal | 228 | 2-685(+) |
Amino Acid sequence : | |||
| PPIKSAACTIFNERYHLMVDANVIAPQRVVRFAKTCRQLQLLTHVSTAFVNGRREGIILEKALNMGDTGRKEGGVGVDVGDEISLLLKSLMLSDYDANKYFRKLGQQRAEEFGWSNTYQL SKSMGEMVVNEIRGDLPLLIIRPAIIESCYRQPLPGWIQGIRMFDPMAISYGKGLLPAYLADPQAPLDIIPADLAANMLIAAIAKHGKGDDKEVKVYHVASGICNPLT | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 25,140.987 | ||
| Theoretical pI: | 8.451 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23170 | ||
| Instability index: | 31.820 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.035 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.228 | ||
| sheet | 0.281 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336011.1 | internal | 228 | 2-685(+) |
Amino Acid sequence : | |||
| PPIKSAACTIFNERYHLMVDANVIAPQRVVRFAKTCRQLQLLTHVSTAFVNGRREGIILEKALNMGDTGRKEGGVGVDVGDEISLLLKSLMLSDYDANKYFRKLGQQRAEEFGWSNTYQL SKSMGEMVVNEIRGDLPLLIIRPAIIESCYRQPLPGWIQGIRMFDPMAISYGKGLLPAYLADPQAPLDIIPADLAANMLIAAIAKHGKGDDKEVKVYHVASGICNPLT | |||
Physicochemical properties | |||
| Number of amino acids: | 228 | ||
| Molecular weight: | 25,140.987 | ||
| Theoretical pI: | 8.451 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23170 | ||
| Instability index: | 31.820 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.035 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.228 | ||
| sheet | 0.281 | ||