Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336011.1 | internal | 228 | 2-685(+) |
Amino Acid sequence : | |||
PPIKSAACTIFNERYHLMVDANVIAPQRVVRFAKTCRQLQLLTHVSTAFVNGRREGIILEKALNMGDTGRKEGGVGVDVGDEISLLLKSLMLSDYDANKYFRKLGQQRAEEFGWSNTYQL SKSMGEMVVNEIRGDLPLLIIRPAIIESCYRQPLPGWIQGIRMFDPMAISYGKGLLPAYLADPQAPLDIIPADLAANMLIAAIAKHGKGDDKEVKVYHVASGICNPLT | |||
Physicochemical properties | |||
Number of amino acids: | 228 | ||
Molecular weight: | 25,140.987 | ||
Theoretical pI: | 8.451 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23170 | ||
Instability index: | 31.820 | ||
aromaticity | 0.070 | ||
GRAVY | -0.035 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.228 | ||
sheet | 0.281 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336011.1 | internal | 228 | 2-685(+) |
Amino Acid sequence : | |||
PPIKSAACTIFNERYHLMVDANVIAPQRVVRFAKTCRQLQLLTHVSTAFVNGRREGIILEKALNMGDTGRKEGGVGVDVGDEISLLLKSLMLSDYDANKYFRKLGQQRAEEFGWSNTYQL SKSMGEMVVNEIRGDLPLLIIRPAIIESCYRQPLPGWIQGIRMFDPMAISYGKGLLPAYLADPQAPLDIIPADLAANMLIAAIAKHGKGDDKEVKVYHVASGICNPLT | |||
Physicochemical properties | |||
Number of amino acids: | 228 | ||
Molecular weight: | 25,140.987 | ||
Theoretical pI: | 8.451 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23170 | ||
Instability index: | 31.820 | ||
aromaticity | 0.070 | ||
GRAVY | -0.035 | ||
Secondary Structure Fraction | |||
Helix | 0.320 | ||
turn | 0.228 | ||
sheet | 0.281 |