Acc_NO	ORF type	length	start-end position (strand +/-)
>DY336024.1	complete	171	76-591(+)
Amino Acid sequence :
MPFKFNTLINKKTKTQKSNKHHFEVKKTHLSLFIRYRTIQPQQKNPSALWLLPLEWLHNFPCEVGIVSPEMPVRRGLQKPPVAPPLQVEVDRNHPWPEVEALLHDLQDLLVGDLPRPVGV HKHRQRLRDTDGVRDLHDAPPCEPPRAEFGTRLFPGKTWTLQLKTSILSLT*
Physicochemical properties
Number of amino acids:		171
Molecular weight:		19,809.792
Theoretical pI:		9.774
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		23490 23615
Instability index:		49.424
aromaticity		0.070
GRAVY		-0.585
Secondary Structure Fraction
Helix		0.304
turn		0.228
sheet		0.228