| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336024.1 | complete | 171 | 76-591(+) |
Amino Acid sequence : | |||
| MPFKFNTLINKKTKTQKSNKHHFEVKKTHLSLFIRYRTIQPQQKNPSALWLLPLEWLHNFPCEVGIVSPEMPVRRGLQKPPVAPPLQVEVDRNHPWPEVEALLHDLQDLLVGDLPRPVGV HKHRQRLRDTDGVRDLHDAPPCEPPRAEFGTRLFPGKTWTLQLKTSILSLT* | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 19,809.792 | ||
| Theoretical pI: | 9.774 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
| Instability index: | 49.424 | ||
| aromaticity | 0.070 | ||
| GRAVY | -0.585 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.228 | ||
| sheet | 0.228 | ||