Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY336024.1 | complete | 171 | 76-591(+) |
Amino Acid sequence : | |||
MPFKFNTLINKKTKTQKSNKHHFEVKKTHLSLFIRYRTIQPQQKNPSALWLLPLEWLHNFPCEVGIVSPEMPVRRGLQKPPVAPPLQVEVDRNHPWPEVEALLHDLQDLLVGDLPRPVGV HKHRQRLRDTDGVRDLHDAPPCEPPRAEFGTRLFPGKTWTLQLKTSILSLT* | |||
Physicochemical properties | |||
Number of amino acids: | 171 | ||
Molecular weight: | 19,809.792 | ||
Theoretical pI: | 9.774 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
Instability index: | 49.424 | ||
aromaticity | 0.070 | ||
GRAVY | -0.585 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.228 | ||
sheet | 0.228 |