| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336028.1 | internal | 243 | 2-730(+) |
Amino Acid sequence : | |||
| HPVVTGNQPDIVMDSLAVHGLGLVHPKKVFNFYNELHAYLASCGVDGVKVDVQNIIETLGAGHGGRVSLTRSYHQALEASIARNFADNGCIACMCHNTDGIYSARQTAVVRASDDYYPRD PASHTIHISSVAYNTIFLGEFMQPDWDMFHSLHPAADYHAAARAVGGCAIYVSDKPGHHNFDLLKKLVLPDGSVLRAQLPGRPTIDCLFVDPARDGTSLLKIWNANKCSGVVGVFNCQGA GWC | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 13,319.240 | ||
| Theoretical pI: | 10.114 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 45.329 | ||
| aromaticity | 0.033 | ||
| GRAVY | -0.320 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.267 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336028.1 | 5prime_partial | 120 | 730-368(-) |
Amino Acid sequence : | |||
| APPRALAVEHTHHSRALVCIPNFKQARSVSGRIHKETVDCGSSGKLCAENGSIGQNKLLQEVEVVVTRLVTNINRTPSYSSSRSMIVSSWMQAMKHIPIRLHKLPQKYGIISHRRDVDGV * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,319.240 | ||
| Theoretical pI: | 10.114 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 45.329 | ||
| aromaticity | 0.033 | ||
| GRAVY | -0.320 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.267 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336028.1 | internal | 243 | 2-730(+) |
Amino Acid sequence : | |||
| HPVVTGNQPDIVMDSLAVHGLGLVHPKKVFNFYNELHAYLASCGVDGVKVDVQNIIETLGAGHGGRVSLTRSYHQALEASIARNFADNGCIACMCHNTDGIYSARQTAVVRASDDYYPRD PASHTIHISSVAYNTIFLGEFMQPDWDMFHSLHPAADYHAAARAVGGCAIYVSDKPGHHNFDLLKKLVLPDGSVLRAQLPGRPTIDCLFVDPARDGTSLLKIWNANKCSGVVGVFNCQGA GWC | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 13,319.240 | ||
| Theoretical pI: | 10.114 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 45.329 | ||
| aromaticity | 0.033 | ||
| GRAVY | -0.320 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.267 | ||
| sheet | 0.192 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336028.1 | 5prime_partial | 120 | 730-368(-) |
Amino Acid sequence : | |||
| APPRALAVEHTHHSRALVCIPNFKQARSVSGRIHKETVDCGSSGKLCAENGSIGQNKLLQEVEVVVTRLVTNINRTPSYSSSRSMIVSSWMQAMKHIPIRLHKLPQKYGIISHRRDVDGV * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,319.240 | ||
| Theoretical pI: | 10.114 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 45.329 | ||
| aromaticity | 0.033 | ||
| GRAVY | -0.320 | ||
Secondary Structure Fraction | |||
| Helix | 0.275 | ||
| turn | 0.267 | ||
| sheet | 0.192 | ||