Acc_NO	ORF type	length	start-end position (strand +/-)
>DY336032.1	complete	185	71-628(+)
Amino Acid sequence :
MGTAPETGQFMALLLKTINARKTLEIGVFTGYSLLLTALAIPHDGKIMAIDINRDTYEIGLPIIEKAGVKHKIDFIESKALPALDHLLKDGENKESFDFAFVDADKVNYANYHERVLELL RPGGIPVYDNTLWGGTIAMAPDLVAESKLQYRNAAEEFNNFIAADSRVQISQLPVGDGITVCRRK*
Physicochemical properties
Number of amino acids:		185
Molecular weight:		13,573.864
Theoretical pI:		10.156
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 14230
Instability index:		33.171
aromaticity		0.087
GRAVY		-0.011
Secondary Structure Fraction
Helix		0.374
turn		0.191
sheet		0.217

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY336032.1	complete	115	676-329(-)
Amino Acid sequence :
MLRKEWNFHFITTYTLSLAATNSNPITHRELRNLNTRVCSNEVVKLLCSIPVLELALRHQIRRHRNGASPQCVVINRYSTWPQKLQHPFMVVCIVHFISIHKREVKTLFILPIFE*
Physicochemical properties
Number of amino acids:		115
Molecular weight:		13,573.864
Theoretical pI:		10.156
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		13980 14230
Instability index:		33.171
aromaticity		0.087
GRAVY		-0.011
Secondary Structure Fraction
Helix		0.374
turn		0.191
sheet		0.217