| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336038.1 | 5prime_partial | 219 | 3-662(+) |
Amino Acid sequence : | |||
| RERDPLSATEIQVESVVFPPAVKPPGSDNLLFLGGAGVRGMEMEGKFIKFTAIGVYLEDSSVAVLAAKWKGKTADELADSDEFVREVITGPFEKLTKVTTILPLTGQQYSEKVAENCTAY WKAVGKYTEAEGEAIAKFLQIFKDETFPPGASILFTQSASGSLTIAFSDDGSVPEQGKAVINNKLLAEAILESIIGRHGVSPTARRSLAARVSELMNLK* | |||
Physicochemical properties | |||
| Number of amino acids: | 219 | ||
| Molecular weight: | 23,556.606 | ||
| Theoretical pI: | 5.135 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 35.331 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.233 | ||
| sheet | 0.301 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336038.1 | 5prime_partial | 219 | 3-662(+) |
Amino Acid sequence : | |||
| RERDPLSATEIQVESVVFPPAVKPPGSDNLLFLGGAGVRGMEMEGKFIKFTAIGVYLEDSSVAVLAAKWKGKTADELADSDEFVREVITGPFEKLTKVTTILPLTGQQYSEKVAENCTAY WKAVGKYTEAEGEAIAKFLQIFKDETFPPGASILFTQSASGSLTIAFSDDGSVPEQGKAVINNKLLAEAILESIIGRHGVSPTARRSLAARVSELMNLK* | |||
Physicochemical properties | |||
| Number of amino acids: | 219 | ||
| Molecular weight: | 23,556.606 | ||
| Theoretical pI: | 5.135 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 35.331 | ||
| aromaticity | 0.078 | ||
| GRAVY | -0.057 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.233 | ||
| sheet | 0.301 | ||