Acc_NO	ORF type	length	start-end position (strand +/-)
>DY336041.1	5prime_partial	209	3-632(+)
Amino Acid sequence :
EXVTWTKPSDSEKPCNINRVNLQPRRAPSKEPTAPPILAYWILGSTGENPRMLRLLKAIYHPRNHYLLQLDSSASHHQRLELSNLAQSERVFQEFGNVDVVGESYAVNPMAASGLAAMLH AAALLLIVRADWDWLIPLSTSDDPILPQDDILYAFSYLPRDVIFMNYNNSTSLQKRQDVGQIAVDPRLYLKEKSSVFYAVKTREKTRFI*
Physicochemical properties
Number of amino acids:		209
Molecular weight:		23,665.748
Theoretical pI:		8.091
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		35410 35410
Instability index:		45.001
aromaticity		0.091
GRAVY		-0.310
Secondary Structure Fraction
Helix		0.327
turn		0.240
sheet		0.274

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY336041.1	5prime_partial	209	3-632(+)
Amino Acid sequence :
EXVTWTKPSDSEKPCNINRVNLQPRRAPSKEPTAPPILAYWILGSTGENPRMLRLLKAIYHPRNHYLLQLDSSASHHQRLELSNLAQSERVFQEFGNVDVVGESYAVNPMAASGLAAMLH AAALLLIVRADWDWLIPLSTSDDPILPQDDILYAFSYLPRDVIFMNYNNSTSLQKRQDVGQIAVDPRLYLKEKSSVFYAVKTREKTRFI*
Physicochemical properties
Number of amino acids:		209
Molecular weight:		23,665.748
Theoretical pI:		8.091
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		35410 35410
Instability index:		45.001
aromaticity		0.091
GRAVY		-0.310
Secondary Structure Fraction
Helix		0.327
turn		0.240
sheet		0.274