| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336044.1 | 5prime_partial | 139 | 3-422(+) |
Amino Acid sequence : | |||
| LSQGVGVIACIGELLEEREAGKTFDVCFRQLKAYADAVPSWDDIVIAYEPVWAIGTGKVATPEQAQEVHVAVRDWLSKNVSAEVASKTRIIYGGSVNGGNSAELAKKEDIDGFLVGGASL KGPEFATIINSVTAKKVAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 14,650.455 | ||
| Theoretical pI: | 5.010 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 23.805 | ||
| aromaticity | 0.072 | ||
| GRAVY | 0.085 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.223 | ||
| sheet | 0.273 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336044.1 | 5prime_partial | 139 | 3-422(+) |
Amino Acid sequence : | |||
| LSQGVGVIACIGELLEEREAGKTFDVCFRQLKAYADAVPSWDDIVIAYEPVWAIGTGKVATPEQAQEVHVAVRDWLSKNVSAEVASKTRIIYGGSVNGGNSAELAKKEDIDGFLVGGASL KGPEFATIINSVTAKKVAA* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 14,650.455 | ||
| Theoretical pI: | 5.010 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 23.805 | ||
| aromaticity | 0.072 | ||
| GRAVY | 0.085 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.223 | ||
| sheet | 0.273 | ||