| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336055.1 | complete | 143 | 16-447(+) |
Amino Acid sequence : | |||
| MGADSKGAQVPLGPKICKEKLENMLDEFSVPRCLFPNLGDCEEFAFNRATGFYWLKKKSKTERKIEKVGTVYYEKELSAFIQHRRLTKITGLKAKELFLTLTVSEILVGVPTDDKVKFVT STGISRAIPITNLEPTMGESSGK* | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 15,977.427 | ||
| Theoretical pI: | 9.115 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 24.273 | ||
| aromaticity | 0.084 | ||
| GRAVY | -0.289 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.217 | ||
| sheet | 0.259 | ||