| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336061.1 | 3prime_partial | 215 | 114-758(+) |
Amino Acid sequence : | |||
| MEISVGTIDANGFSAKHVAAYYYFVPPYVYYGRITPNAATKTKDATLPVVPEEKTAMIVFYCIPVTPGYSRLIYAGARNFAVQIDRFVPRWITHMSHDLIFDSDLFLLHVEEQKLKDLDW HRSCYIPTKADGQVVSFTRWLNKYGGTQVDWRNNFTPALPPTPSREQLFDRYWSHTAECSSCSVACKRLNALEIGLQAMSLVFVAMAAAVSAPAT | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 17,353.853 | ||
| Theoretical pI: | 6.132 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36815 | ||
| Instability index: | 43.138 | ||
| aromaticity | 0.120 | ||
| GRAVY | 0.027 | ||
Secondary Structure Fraction | |||
| Helix | 0.373 | ||
| turn | 0.213 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336061.1 | complete | 150 | 476-24(-) |
Amino Acid sequence : | |||
| MPVQILELLLLDMKKKEIGIKNQVVGHMSDPAWHESINLDSEIPGTSVDEPAVTRCNWDAVENNHGCFLLRNYWQRRIFSFCGGVWSNTAVVYVRWNEVVICCHMLCTETIGIYCSNAYF HLVSSLYVTLRTLFHFLKFQYPIDAHKEPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 17,353.853 | ||
| Theoretical pI: | 6.132 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36815 | ||
| Instability index: | 43.138 | ||
| aromaticity | 0.120 | ||
| GRAVY | 0.027 | ||
Secondary Structure Fraction | |||
| Helix | 0.373 | ||
| turn | 0.213 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336061.1 | 3prime_partial | 215 | 114-758(+) |
Amino Acid sequence : | |||
| MEISVGTIDANGFSAKHVAAYYYFVPPYVYYGRITPNAATKTKDATLPVVPEEKTAMIVFYCIPVTPGYSRLIYAGARNFAVQIDRFVPRWITHMSHDLIFDSDLFLLHVEEQKLKDLDW HRSCYIPTKADGQVVSFTRWLNKYGGTQVDWRNNFTPALPPTPSREQLFDRYWSHTAECSSCSVACKRLNALEIGLQAMSLVFVAMAAAVSAPAT | |||
Physicochemical properties | |||
| Number of amino acids: | 215 | ||
| Molecular weight: | 17,353.853 | ||
| Theoretical pI: | 6.132 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36815 | ||
| Instability index: | 43.138 | ||
| aromaticity | 0.120 | ||
| GRAVY | 0.027 | ||
Secondary Structure Fraction | |||
| Helix | 0.373 | ||
| turn | 0.213 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336061.1 | complete | 150 | 476-24(-) |
Amino Acid sequence : | |||
| MPVQILELLLLDMKKKEIGIKNQVVGHMSDPAWHESINLDSEIPGTSVDEPAVTRCNWDAVENNHGCFLLRNYWQRRIFSFCGGVWSNTAVVYVRWNEVVICCHMLCTETIGIYCSNAYF HLVSSLYVTLRTLFHFLKFQYPIDAHKEPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 17,353.853 | ||
| Theoretical pI: | 6.132 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36815 | ||
| Instability index: | 43.138 | ||
| aromaticity | 0.120 | ||
| GRAVY | 0.027 | ||
Secondary Structure Fraction | |||
| Helix | 0.373 | ||
| turn | 0.213 | ||
| sheet | 0.220 | ||