| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336071.1 | 5prime_partial | 162 | 502-14(-) |
Amino Acid sequence : | |||
| HEALFSPSQSKPMSKRRTREPKEENVTLGPATRDGELVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMKVKADRDESSPYAAMLAAQDVSQRCKELGINALHIKLRATGGNKTKTPG PGAQSALRALARSGMKIGRIEDVTPIPTDSTRRKGAIRGGSL* | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 12,069.788 | ||
| Theoretical pI: | 9.301 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21345 | ||
| Instability index: | 46.293 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.149 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.278 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336071.1 | 5prime_partial | 109 | 2-331(+) |
Amino Acid sequence : | |||
| VEXKLEAPSPYGALSPGAVSWDWSNILYTSNLHARTCKGSKCRLSTWTRCLGLISPSRTELNVKSIYTQFLASLRNILCSKHSCIGRRLIPVSFDLHTTCNADHCFTPR* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,069.788 | ||
| Theoretical pI: | 9.301 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21345 | ||
| Instability index: | 46.293 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.149 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.278 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336071.1 | 5prime_partial | 162 | 502-14(-) |
Amino Acid sequence : | |||
| HEALFSPSQSKPMSKRRTREPKEENVTLGPATRDGELVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMKVKADRDESSPYAAMLAAQDVSQRCKELGINALHIKLRATGGNKTKTPG PGAQSALRALARSGMKIGRIEDVTPIPTDSTRRKGAIRGGSL* | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 12,069.788 | ||
| Theoretical pI: | 9.301 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21345 | ||
| Instability index: | 46.293 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.149 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.278 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336071.1 | 5prime_partial | 109 | 2-331(+) |
Amino Acid sequence : | |||
| VEXKLEAPSPYGALSPGAVSWDWSNILYTSNLHARTCKGSKCRLSTWTRCLGLISPSRTELNVKSIYTQFLASLRNILCSKHSCIGRRLIPVSFDLHTTCNADHCFTPR* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,069.788 | ||
| Theoretical pI: | 9.301 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21345 | ||
| Instability index: | 46.293 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.149 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.278 | ||
| sheet | 0.204 | ||