| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336072.1 | internal | 232 | 1-696(+) |
Amino Acid sequence : | |||
| SLFLSIIHHALAIVGTMASSGQTVLQYVPSPASVSATVHPLVIFNICDCYVRRPDQSDRVIGTLLGSVLPDGTVDIRNSYADPHNESSDQVALDIDYHQNMLSSQQKVNPKEVIVGWFST GGVTAGSALIHEFYSREVNSPIHLTVDTEFRNGSPSIKAFVSVGLSLGDQQLAAQFQEIPLDLRMVEAEKIGFDVLKPTIVDKLPNDLEGMEASMERLLALIDDIYKYVDDV | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 12,341.660 | ||
| Theoretical pI: | 11.670 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
| Instability index: | 72.808 | ||
| aromaticity | 0.065 | ||
| GRAVY | 0.150 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.206 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336072.1 | 5prime_partial | 107 | 2-325(+) |
Amino Acid sequence : | |||
| RSSSPSSTMHSLSLEQWRLAVKQCFSTCHRRQACRLQFTRLSYSISAIVTSGGRTNRIALLARYSDLFCLMAPLTFAIPMRILTMSHRIRLPLILIIIRICCRRSRK* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,341.660 | ||
| Theoretical pI: | 11.670 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
| Instability index: | 72.808 | ||
| aromaticity | 0.065 | ||
| GRAVY | 0.150 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.206 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336072.1 | internal | 232 | 1-696(+) |
Amino Acid sequence : | |||
| SLFLSIIHHALAIVGTMASSGQTVLQYVPSPASVSATVHPLVIFNICDCYVRRPDQSDRVIGTLLGSVLPDGTVDIRNSYADPHNESSDQVALDIDYHQNMLSSQQKVNPKEVIVGWFST GGVTAGSALIHEFYSREVNSPIHLTVDTEFRNGSPSIKAFVSVGLSLGDQQLAAQFQEIPLDLRMVEAEKIGFDVLKPTIVDKLPNDLEGMEASMERLLALIDDIYKYVDDV | |||
Physicochemical properties | |||
| Number of amino acids: | 232 | ||
| Molecular weight: | 12,341.660 | ||
| Theoretical pI: | 11.670 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
| Instability index: | 72.808 | ||
| aromaticity | 0.065 | ||
| GRAVY | 0.150 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.206 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336072.1 | 5prime_partial | 107 | 2-325(+) |
Amino Acid sequence : | |||
| RSSSPSSTMHSLSLEQWRLAVKQCFSTCHRRQACRLQFTRLSYSISAIVTSGGRTNRIALLARYSDLFCLMAPLTFAIPMRILTMSHRIRLPLILIIIRICCRRSRK* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,341.660 | ||
| Theoretical pI: | 11.670 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
| Instability index: | 72.808 | ||
| aromaticity | 0.065 | ||
| GRAVY | 0.150 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.206 | ||
| sheet | 0.243 | ||