| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336074.1 | complete | 131 | 100-495(+) |
Amino Acid sequence : | |||
| MMWIMRSIRRPFVQFHAAAAANFSSSAAAVEAERCIREGARNDWKREEIKSIYDSPILDLLFHAAQVHRHAHNFREVQQCTLLSIKTGGCSEDCSYCPQSSRYNTGLKAHKLMNKNVVLE AAKKVKFFCMS* | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 14,938.093 | ||
| Theoretical pI: | 9.299 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15845 | ||
| Instability index: | 56.094 | ||
| aromaticity | 0.092 | ||
| GRAVY | -0.301 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.191 | ||
| sheet | 0.282 | ||