| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336076.1 | internal | 133 | 3-401(+) |
Amino Acid sequence : | |||
| LWHGNRRSHWWWRRFALNRLHRPKLGSRCSLLACATPHILLWKGFPLPLYPRIPGHKGAGVIENVGEKVTNLKVGDTVMPLSIGECGECSNCATGKTNICFKYPPGIAGLMPDGTSRMPA KGQKLYHMFSCST | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 11,337.928 | ||
| Theoretical pI: | 11.371 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 64.216 | ||
| aromaticity | 0.121 | ||
| GRAVY | -0.342 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.303 | ||
| sheet | 0.172 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336076.1 | 3prime_partial | 99 | 298-2(-) |
Amino Acid sequence : | |||
| MFVFPVAQLEHSPHSPMERGITVSPTLRFVTFSPTFSITPAPLCPGIRGYRGRGKPFQSRICGVAHASSEHLDPNFGRWRRFNANLLHHQWLRRFPCHS | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,337.928 | ||
| Theoretical pI: | 11.371 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 64.216 | ||
| aromaticity | 0.121 | ||
| GRAVY | -0.342 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.303 | ||
| sheet | 0.172 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336076.1 | internal | 133 | 3-401(+) |
Amino Acid sequence : | |||
| LWHGNRRSHWWWRRFALNRLHRPKLGSRCSLLACATPHILLWKGFPLPLYPRIPGHKGAGVIENVGEKVTNLKVGDTVMPLSIGECGECSNCATGKTNICFKYPPGIAGLMPDGTSRMPA KGQKLYHMFSCST | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 11,337.928 | ||
| Theoretical pI: | 11.371 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 64.216 | ||
| aromaticity | 0.121 | ||
| GRAVY | -0.342 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.303 | ||
| sheet | 0.172 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY336076.1 | 3prime_partial | 99 | 298-2(-) |
Amino Acid sequence : | |||
| MFVFPVAQLEHSPHSPMERGITVSPTLRFVTFSPTFSITPAPLCPGIRGYRGRGKPFQSRICGVAHASSEHLDPNFGRWRRFNANLLHHQWLRRFPCHS | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,337.928 | ||
| Theoretical pI: | 11.371 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 64.216 | ||
| aromaticity | 0.121 | ||
| GRAVY | -0.342 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.303 | ||
| sheet | 0.172 | ||